Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help

REST interface

Many services accessible via the new web interface work via a REST interface. This REST interface is publicly available for users. Examples are also available. The PDBj REST services are available under the /rest/ URL. Search API URLhttps://pdbj.org/ ...

Obtain the PDBID + ChainID (auth_asym_id) of the entries containing the sequence \

- Search - PDBj Mine - SQL Search - Get each value of PDBID+ChainID (auth_asym_id) for structure which includes both sequence "TVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGR" and resouce species "Glycine max" (soybean) Search from here SELECT b. ...

[wwPDB] Improvements to Data Replacement Prior to Release; Privacy Policy Update

Improvements to Data Replacement Prior to Release; Privacy Policy Update (wwPDB news)

[wwPDB] Conclusion of ORI Misconduct Review Results in Obsoletion of PDB Structures

Conclusion of ORI Misconduct Review Results in Obsoletion of PDB Structures (wwPDB news)

Customizing the PDBj web interface

[Direct panel customization] PDBj's new web interface's home PDBj web interface features it's main menu on the left side of the page. Each category has now been split up with each category having it's own panel. The main menu remains unchanged for all ...

Interactive Tutorial Series

PDBj web interface offers various new and exciting features. One of these features are the interactive tutorials. These tutorials will guide you through the various function of PDBj web interface. Currently available interactive tutorials: An ...

PDBj website browser requirements

PDBj website implements cutting-edge technology. To make full use of our web interface, we recommend users to use the latest version of the most commonly used browsers and have JavaScript enabled. The latest version of browsers provide users with new ...

[wwPDB] Protein Structures Sought for CASP13

Protein Structures Sought for CASP13 (wwPDB news)

[wwPDB] Access Updated Validation Reports for PDB Structures

Access Updated Validation Reports for PDB Structures (wwPDB news)

PDBj Mine

PDBj Mine is a web interface to search the PDB. PDBj Mine has the following basic features: 1. PDBj Mine is based on a relational database. 2. Allows enhanced keyword search. 3. Detailed queries can be performed using using SQL. - PDBj Mine:SQL ...

[wwPDB] wwPDB Biocuration Highlighted in New Publication

wwPDB Biocuration Highlighted in New Publication (wwPDB news)

The new version of jV was released (4.5.4)

We announce the new version of jV, Java based molecular viewer, was released. The latest version is 4.5.4. There is no functional change compared to the previous version. Only the certification for signing was updated. In some cases update procedure is ...

eF-surf

eF-surf is a web service to calculate the electrostatic potential and molecular surface of proteins from the atomic coordinate of proteins in PDB format. The electrostiatic potentials are calculated by solving the Poisson-Bolzman equation numerically. ...

eF-seek

eF-seek is a web server to search for the similar ligand binding sites for the uploaded coordinate file with PDB format. The representative binding sites in eF-site database are searched by our own algorithm based on the clique search algorithm. eF-seek ...

[wwPDB] Time-stamped Copies of the PDB Archive Available

Time-stamped Copies of the PDB Archive Available (wwPDB news)

PDBj FTP site (PDB Archive) is available via \

The PDB Archive download service is now available via the http protocol in addition to ftp and rsync. - http://ftp.pdbj.org/ (current main PDB Archive) - http://ftp-versioned.pdbj.org/ (versioned PDB Archive) *Please see also "About contents in PDBj ...

A paper describing PDBj's new tools and activities published in Protein Science.

http://onlinelibrary.wiley.com/doi/10.1002/pro.3273/full New tools and functions in Data-out activities at Protein Data Bank Japan (PDBj) Kinjo, A.R., Bekker, G.-J., Wako, H., Endo, S., Tsuchiya, Y., Sato, H., Nishi, H., Kinoshita, K., Suzuki, H., ...

eF-site

About eF-site eF-site (electrostatic-surface of Functional site) is a database for molecular surfaces of proteins' functional sites, displaying the electrostatic potentials and hydrophobic properties together on the Connolly surfaces of the active sites, ...

The new version of the Mine2 RDB has been released.

The new version includes Chemical Component(cc), Chemical Component Model(ccmodel) and BIRD molecule(prd) schema. The schema of the PDBj Mine 2 RDB has also been upgraded to pdbx-v50-v5.287. Please download the dump files for the new cc, ccmodel and prd. ...

[wwPDB] Overview of PDB Validation Reports published in Structure

Overview of PDB Validation Reports published in Structure (wwPDB news)

Individual Chemical Component Dictionary files (in mmCIF and PDBML) are now available at PDBj's FTP archive.

Individual Chemical Component Dictionary files (in mmCIF and PDBML) are now available at PDBj's FTP archive. For more details, please try Chemie search and chem_comp/RDF service.

We will exhibit at \

Science Agora 2017 -in Tokyo- Science Agora is a generic term for a place connecting science and society, which is open to everyone. People gathering in this forum will aim to realize “science harmonized with society” and a “society harmonized with science ...

Format Conversion: Do you provide a service to convert the file format between PDB format and PDBx/mmCIF? - FAQ

Q) Format Conversion: Do you provide a service to convert the file format between PDB format and PDBx/mmCIF? A) By using our Format Conversion web service, you can convert the file format between PDB format and PDBx/mmCIF. [Back to the question list]

Mail to pdbj-master

Please refer to the FAQ page. If you cannot find the answers to your questions, please contact us using the question form below. Please include the service name in your Message or Subject if you have any problems or questions about PDBj services.

Tutorial for OneDep deposition service - FAQ

Q) Is any tutorial for OneDep deposition service available? A) Please refer to tutorial page at PDBj site. Other information regarding deposition is provided at Data Deposition Information page. [Back to Questions]

224931

PDB entries from 2024-09-11

PDB statisticsPDBj update infoContact PDBjnumon