Obtain the PDBID + ChainID (auth_asym_id) of the entries containing the sequence \

• Search
• PDBj Mine
• SQL Search
• Get each value of PDBID＋ChainID (auth_asym_id) for structure which includes both sequence "TVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGR" and resouce species "Glycine max" (soybean)

Search from here

SELECT b.pdbid, e.pdbx_strand_id FROM entity_poly e
LEFT JOIN brief_summary b ON e.pdbid=b.pdbid
WHERE e.pdbx_seq_one_letter_code LIKE '%TVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGR%'
AND b.biol_species LIKE '%Glycine max%'

• To use brief_summary table is convenient because the category that biological resource information is described is vary according to get the molecule.
• If ChainID is not necessary, it is enough to refer brief_summary.aaseq, which includes all the sequence information in each PDB entry.

Element	Contents
entity_src_nat	The biological resource information when the molecule is derived from the species directly.
entity_src_nat	The biological resource information when the molecule is derived by using another host species.
pdbx_entity_src_syn	The biological resource information when the molecule is synthesized.
brief_summary.biol_species	The value that is concatenated all the species name in each PDB entry.
entity_poly.pdbx_seq_one_letter_code	The amino acid or nucleic acid sequence in each PDB entry.
brief_summary.aaseq	The value that is concatenated all the sequence in each PDB entry.