Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
Info pages: 555 results

[wwPDB] Time-stamped Copies of the PDB Archive Available

Time-stamped Copies of the PDB Archive Available (wwPDB news)

[wwPDB] New PDB archive reference paper now in NAR 2019 Database issue

New PDB archive reference paper now in NAR 2019 Database issue (wwPDB news)

On 17th Nov (Sat), we exhibit a booth at the event \

Co-Creation Bureau, Osaka University "Enjoy with Osaka Univ." In this event, we exhibit booths and experience corners to introduce various study, result, and resources of Osaka University in the event site. From children to adults, various people can ...

On 10 Nov (Sat) and 11 (Sun), we exhibit a booth in \

Science Agora 2018 - in Tokyo - Science Agora is an event to find something fun or curious about science, enjoy and discuss together, and share the experience. In this year, it is held from 9th Nov 2018 (Fri) to 11th Nov 2018 (Sun) (JST). The venue is ...

List of entries replaced with obsolete or other ID - FAQ

Q) Is there the obsoleted/superseded entries list? A) We provide it at PDBj FTP site. See also About contents in PDBj FTP site for more details. [Back to Questions]

Molmil 2 has become the default viewer of PDBj web interface from Nov. 1st, 2018

The PDBj web interface uses the beta version of Molmil 2, an enhanced version of the current Molmil, from November 1st 2018 by default. To keep using the old Molmil 1 interface, please select "Molmil 1" under the default selected viewer on the ...

Molmil user manual

Introduction Molmil is a molecular viewer developped by PDBj and used in PDBj services same as jV. It works with typical web browsers. It can be used for embedded objects in web pages as well as for stand-alone viewer. Usage In Molmil, the loaded ...

[wwPDB] OneDep Improves Support for Deposition of XFEL/SFX Structures

OneDep Improves Support for Deposition of XFEL/SFX Structures (wwPDB news)

mmJSON files now available from our FTP

The mmJSON files previously accessible via our REST interface are now also accessible from our ftp site. For more information, please refer to our mmJSON help page.

mmjson

The PDBx/mmJSON file format is a JSON representation of the PDBx/mmCIF data developed by PDBj. The following services use the mmJSON format directly: - Mine PDB Explorer - Mine CIF Query service - Molmil - CIF tree tool Implementation details and PDBx/ ...

wwPDB/RDF

URL: http://rdf.wwpdb.org/pdb PDB/RDF is a collection of PDB data in the Resource Description Framework (RDF) format. The RDF format is the standard format for the Semantic Web. An ontology defined in the Web Ontology Language (OWL) is also provided for ...

[wwPDB] PDB Certified as a Trustworthy Data Repository

PDB Certified as a Trustworthy Data Repository (wwPDB news)

PDBj omni-search functionality

The new PDBj omni-search functionality allows you to more quickly find the resource or service you're looking for. While you're typing, PDBj searches through several of our databases for matches regarding your query: Searching for "ubi" using the PDBj ...

[wwPDB] Depositing a Structure? Include Your ORCiD

Depositing a Structure? Include Your ORCiD (wwPDB news)

[wwPDB] ORCIDs to become mandatory for OneDep contact authors

ORCIDs to become mandatory for OneDep contact authors (wwPDB news)

REST interface

Many services accessible via the new web interface work via a REST interface. This REST interface is publicly available for users. Examples are also available. The PDBj REST services are available under the /rest/ URL. Search API URLhttps://pdbj.org/ ...

Obtain the PDBID + ChainID (auth_asym_id) of the entries containing the sequence \

- Search - PDBj Mine - SQL Search - Get each value of PDBID+ChainID (auth_asym_id) for structure which includes both sequence "TVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGR" and resouce species "Glycine max" (soybean) Search from here SELECT b. ...

[wwPDB] Improvements to Data Replacement Prior to Release; Privacy Policy Update

Improvements to Data Replacement Prior to Release; Privacy Policy Update (wwPDB news)

[wwPDB] Conclusion of ORI Misconduct Review Results in Obsoletion of PDB Structures

Conclusion of ORI Misconduct Review Results in Obsoletion of PDB Structures (wwPDB news)

Customizing the PDBj web interface

[Direct panel customization] PDBj's new web interface's home PDBj web interface features it's main menu on the left side of the page. Each category has now been split up with each category having it's own panel. The main menu remains unchanged for all ...

Interactive Tutorial Series

PDBj web interface offers various new and exciting features. One of these features are the interactive tutorials. These tutorials will guide you through the various function of PDBj web interface. Currently available interactive tutorials: An ...

PDBj website browser requirements

PDBj website implements cutting-edge technology. To make full use of our web interface, we recommend users to use the latest version of the most commonly used browsers and have JavaScript enabled. The latest version of browsers provide users with new ...

[wwPDB] Protein Structures Sought for CASP13

Protein Structures Sought for CASP13 (wwPDB news)

[wwPDB] Access Updated Validation Reports for PDB Structures

Access Updated Validation Reports for PDB Structures (wwPDB news)

PDBj Mine

PDBj Mine is a web interface to search the PDB. PDBj Mine has the following basic features: 1. PDBj Mine is based on a relational database. 2. Allows enhanced keyword search. 3. Detailed queries can be performed using using SQL. - PDBj Mine:SQL ...

238582

PDB entries from 2025-07-09

PDB statisticsPDBj update infoContact PDBjnumon