[English] 日本語
Yorodumi
- PDB-5ong: X-Ray crystal structure of a nucleosome core particle with its DN... -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 5ong
TitleX-Ray crystal structure of a nucleosome core particle with its DNA site-specifically crosslinked to the histone octamer
Components
  • (DNA (147-MER)) x 2
  • Histone H2A
  • Histone H2B 1.1
  • Histone H3.2
  • Histone H4
KeywordsDNA BINDING PROTEIN / Nucleosome Core Particle / Histones / Disulfide / Convertible Nucleotide / DNA
Function / homology
Function and homology information


nucleosomal DNA binding / innate immune response in mucosa / structural constituent of chromatin / nucleosome / nucleosome assembly / chromatin organization / antimicrobial humoral immune response mediated by antimicrobial peptide / heterochromatin formation / antibacterial humoral response / protein heterodimerization activity ...nucleosomal DNA binding / innate immune response in mucosa / structural constituent of chromatin / nucleosome / nucleosome assembly / chromatin organization / antimicrobial humoral immune response mediated by antimicrobial peptide / heterochromatin formation / antibacterial humoral response / protein heterodimerization activity / : / DNA binding / nucleoplasm / nucleus
Similarity search - Function
Histone, subunit A / Histone, subunit A / : / Histone H2A conserved site / Histone H2A signature. / Histone H2B signature. / Histone H2B / Histone H2B / Histone H2A, C-terminal domain / C-terminus of histone H2A ...Histone, subunit A / Histone, subunit A / : / Histone H2A conserved site / Histone H2A signature. / Histone H2B signature. / Histone H2B / Histone H2B / Histone H2A, C-terminal domain / C-terminus of histone H2A / Histone 2A / Histone H2A / TATA box binding protein associated factor / TATA box binding protein associated factor (TAF), histone-like fold domain / Histone H4, conserved site / Histone H4 signature. / Histone H4 / Histone H4 / CENP-T/Histone H4, histone fold / Centromere kinetochore component CENP-T histone fold / Histone H3 signature 1. / Histone H3 signature 2. / Histone H3 / Histone H3/CENP-A / Histone H2A/H2B/H3 / Core histone H2A/H2B/H3/H4 domain / Histone-fold / Orthogonal Bundle / Mainly Alpha
Similarity search - Domain/homology
: / DNA / DNA (> 10) / DNA (> 100) / Histone H2B 1.1 / Histone H2A type 1 / Histone H4 / Histone H3.2 / Histone H2A
Similarity search - Component
Biological speciesHomo sapiens (human)
Xenopus laevis (African clawed frog)
MethodX-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 2.797 Å
AuthorsFrouws, T.D. / Barth, P.D. / Richmond, T.J.
Funding support Switzerland, 1items
OrganizationGrant numberCountry
Louis Jeantet Prize Switzerland
CitationJournal: J. Mol. Biol. / Year: 2018
Title: Site-Specific Disulfide Crosslinked Nucleosomes with Enhanced Stability.
Authors: Frouws, T.D. / Barth, P.D. / Richmond, T.J.
History
DepositionAug 3, 2017Deposition site: PDBE / Processing site: PDBE
Revision 1.0Nov 22, 2017Provider: repository / Type: Initial release
Revision 1.1Dec 27, 2017Group: Database references / Category: citation
Item: _citation.journal_volume / _citation.page_first ..._citation.journal_volume / _citation.page_first / _citation.page_last / _citation.year
Revision 1.2Jan 17, 2024Group: Data collection / Database references ...Data collection / Database references / Derived calculations / Refinement description
Category: chem_comp_atom / chem_comp_bond ...chem_comp_atom / chem_comp_bond / database_2 / pdbx_initial_refinement_model / pdbx_struct_conn_angle / struct_conn / struct_conn_type
Item: _database_2.pdbx_DOI / _database_2.pdbx_database_accession ..._database_2.pdbx_DOI / _database_2.pdbx_database_accession / _pdbx_struct_conn_angle.ptnr1_auth_asym_id / _pdbx_struct_conn_angle.ptnr1_auth_comp_id / _pdbx_struct_conn_angle.ptnr1_auth_seq_id / _pdbx_struct_conn_angle.ptnr1_label_asym_id / _pdbx_struct_conn_angle.ptnr1_label_atom_id / _pdbx_struct_conn_angle.ptnr1_label_comp_id / _pdbx_struct_conn_angle.ptnr1_label_seq_id / _pdbx_struct_conn_angle.ptnr1_symmetry / _pdbx_struct_conn_angle.ptnr2_auth_asym_id / _pdbx_struct_conn_angle.ptnr2_auth_seq_id / _pdbx_struct_conn_angle.ptnr2_label_asym_id / _pdbx_struct_conn_angle.ptnr2_symmetry / _pdbx_struct_conn_angle.ptnr3_auth_asym_id / _pdbx_struct_conn_angle.ptnr3_auth_comp_id / _pdbx_struct_conn_angle.ptnr3_auth_seq_id / _pdbx_struct_conn_angle.ptnr3_label_asym_id / _pdbx_struct_conn_angle.ptnr3_label_atom_id / _pdbx_struct_conn_angle.ptnr3_label_comp_id / _pdbx_struct_conn_angle.ptnr3_label_seq_id / _pdbx_struct_conn_angle.ptnr3_symmetry / _pdbx_struct_conn_angle.value / _struct_conn.conn_type_id / _struct_conn.id / _struct_conn.pdbx_dist_value / _struct_conn.pdbx_leaving_atom_flag / _struct_conn.ptnr1_auth_asym_id / _struct_conn.ptnr1_auth_comp_id / _struct_conn.ptnr1_auth_seq_id / _struct_conn.ptnr1_label_asym_id / _struct_conn.ptnr1_label_atom_id / _struct_conn.ptnr1_label_comp_id / _struct_conn.ptnr1_label_seq_id / _struct_conn.ptnr1_symmetry / _struct_conn.ptnr2_auth_asym_id / _struct_conn.ptnr2_auth_comp_id / _struct_conn.ptnr2_auth_seq_id / _struct_conn.ptnr2_label_asym_id / _struct_conn.ptnr2_label_atom_id / _struct_conn.ptnr2_label_comp_id / _struct_conn.ptnr2_label_seq_id / _struct_conn.ptnr2_symmetry / _struct_conn_type.id
Revision 1.3Nov 13, 2024Group: Structure summary / Category: pdbx_entry_details / pdbx_modification_feature / Item: _pdbx_entry_details.has_protein_modification

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
I: DNA (147-MER)
J: DNA (147-MER)
A: Histone H3.2
B: Histone H4
C: Histone H2A
D: Histone H2B 1.1
E: Histone H3.2
F: Histone H4
G: Histone H2A
H: Histone H2B 1.1
hetero molecules


Theoretical massNumber of molelcules
Total (without water)200,32234
Polymers199,08210
Non-polymers1,24124
Water1,56787
1


  • Idetical with deposited unit
  • defined by author&software
  • Evidence: gel filtration
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Buried area60470 Å2
ΔGint-518 kcal/mol
Surface area72040 Å2
MethodPISA
Unit cell
Length a, b, c (Å)106.240, 183.130, 109.490
Angle α, β, γ (deg.)90.00, 90.00, 90.00
Int Tables number19
Space group name H-MP212121

-
Components

-
DNA chain , 2 types, 2 molecules IJ

#1: DNA chain DNA (147-MER)


Mass: 45430.148 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Production host: Escherichia coli (E. coli) / Variant (production host): DH10B
#2: DNA chain DNA (147-MER)


Mass: 45421.133 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Production host: Escherichia coli (E. coli) / Variant (production host): DH10B

-
Protein , 4 types, 8 molecules AEBFCGDH

#3: Protein Histone H3.2


Mass: 15217.812 Da / Num. of mol.: 2 / Mutation: C110A, R40C
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Xenopus laevis (African clawed frog) / Production host: Escherichia coli BL21(DE3) (bacteria) / Variant (production host): pLysS / References: UniProt: P84233
#4: Protein Histone H4


Mass: 11394.426 Da / Num. of mol.: 2
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Xenopus laevis (African clawed frog) / Production host: Escherichia coli BL21(DE3) (bacteria) / Variant (production host): pLysS / References: UniProt: P62799
#5: Protein Histone H2A


Mass: 13978.241 Da / Num. of mol.: 2
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Xenopus laevis (African clawed frog) / Gene: hist1h2aj, LOC494591 / Production host: Escherichia coli BL21(DE3) (bacteria) / Variant (production host): pLysS / References: UniProt: Q6AZJ8, UniProt: P06897*PLUS
#6: Protein Histone H2B 1.1 / H2B1.1


Mass: 13524.752 Da / Num. of mol.: 2
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Xenopus laevis (African clawed frog) / Production host: Escherichia coli BL21(DE3) (bacteria) / Variant (production host): pLysS / References: UniProt: P02281

-
Non-polymers , 3 types, 111 molecules

#7: Chemical
ChemComp-MN / MANGANESE (II) ION


Mass: 54.938 Da / Num. of mol.: 20 / Source method: obtained synthetically / Formula: Mn
#8: Chemical
ChemComp-CL / CHLORIDE ION


Mass: 35.453 Da / Num. of mol.: 4 / Source method: isolated from a natural source / Formula: Cl
#9: Water ChemComp-HOH / water


Mass: 18.015 Da / Num. of mol.: 87 / Source method: isolated from a natural source / Formula: H2O

-
Details

Has protein modificationY
Sequence detailsconstructs were all sequenced and the expressed protein MW was confirmed by mass spec: 30268543:42- ...constructs were all sequenced and the expressed protein MW was confirmed by mass spec: 30268543:42-452 Expression vector pET3-H3 H3 gene for Xenopus laevis-like histone H3 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 30268542|emb|CAD89678.1| Xenopus laevis-like histone H2B [Expression vector pET3-H2B] MAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFER IAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

-
Experimental details

-
Experiment

ExperimentMethod: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

CrystalDensity Matthews: 3.01 Å3/Da / Density % sol: 59.09 % / Description: hollow hexagonal rods
Crystal growTemperature: 295 K / Method: vapor diffusion, sitting drop / pH: 6
Details: Sample was mixed in a 1:1 ratio with 10 mM Na-cacodylate, pH 6.0, 130-180 mM MnCl2, 100-160 mM KCl and equilibrated against a 1:4 dilution of the same solution

-
Data collection

DiffractionMean temperature: 90 K
Diffraction sourceSource: SYNCHROTRON / Site: SLS / Beamline: X06SA / Wavelength: 1 Å
DetectorType: DECTRIS PILATUS 6M-F / Detector: PIXEL / Date: Sep 11, 2014
RadiationProtocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelengthWavelength: 1 Å / Relative weight: 1
ReflectionResolution: 2.797→29.54 Å / Num. obs: 47952 / % possible obs: 90.3 % / Redundancy: 3.3 % / Rmerge(I) obs: 0.084 / Net I/σ(I): 12.7
Reflection shellResolution: 2.797→2.95 Å / Rmerge(I) obs: 0.231 / Mean I/σ(I) obs: 2.5 / % possible all: 68

-
Processing

Software
NameVersionClassification
PHENIX(dev_2447: ???)refinement
XDSdata reduction
SCALAdata scaling
PHASERphasing
RefinementMethod to determine structure: MOLECULAR REPLACEMENT
Starting model: 1KX5
Resolution: 2.797→29.499 Å / SU ML: 0.35 / Cross valid method: FREE R-VALUE / σ(F): 1.34 / Phase error: 25.76
RfactorNum. reflection% reflectionSelection details
Rfree0.2468 4812 10.07 %random
Rwork0.2057 ---
obs0.2098 47779 89.43 %-
Solvent computationShrinkage radii: 0.9 Å / VDW probe radii: 1.11 Å
Refinement stepCycle: LAST / Resolution: 2.797→29.499 Å
ProteinNucleic acidLigandSolventTotal
Num. atoms5973 6027 24 87 12111
Refine LS restraints
Refine-IDTypeDev idealNumber
X-RAY DIFFRACTIONf_bond_d0.00312813
X-RAY DIFFRACTIONf_angle_d0.59718563
X-RAY DIFFRACTIONf_dihedral_angle_d26.1026679
X-RAY DIFFRACTIONf_chiral_restr0.0362109
X-RAY DIFFRACTIONf_plane_restr0.0241473
LS refinement shell
Resolution (Å)Rfactor RfreeNum. reflection RfreeRfactor RworkNum. reflection RworkRefine-ID% reflection obs (%)
2.7973-2.82910.4036970.3838822X-RAY DIFFRACTION52
2.8291-2.86230.42311180.35081076X-RAY DIFFRACTION69
2.8623-2.89720.33841350.30281145X-RAY DIFFRACTION72
2.8972-2.93390.33391300.27711096X-RAY DIFFRACTION70
2.9339-2.97240.32581490.27721289X-RAY DIFFRACTION82
2.9724-3.01310.30881640.26291450X-RAY DIFFRACTION92
3.0131-3.05610.30141410.2431483X-RAY DIFFRACTION92
3.0561-3.10170.2911630.25281446X-RAY DIFFRACTION92
3.1017-3.15010.28691700.24061431X-RAY DIFFRACTION91
3.1501-3.20170.27141430.24271518X-RAY DIFFRACTION94
3.2017-3.25680.2921660.27031521X-RAY DIFFRACTION96
3.2568-3.3160.28281640.25191528X-RAY DIFFRACTION95
3.316-3.37970.30541510.27261496X-RAY DIFFRACTION95
3.3797-3.44850.29981860.27461464X-RAY DIFFRACTION93
3.4485-3.52340.26721690.24641488X-RAY DIFFRACTION94
3.5234-3.60520.28541560.21241478X-RAY DIFFRACTION94
3.6052-3.69520.25711730.22311510X-RAY DIFFRACTION95
3.6952-3.79490.24521940.21271525X-RAY DIFFRACTION95
3.7949-3.90640.24531700.1961528X-RAY DIFFRACTION96
3.9064-4.03210.22041840.19111492X-RAY DIFFRACTION95
4.0321-4.17590.23361740.1821500X-RAY DIFFRACTION94
4.1759-4.34260.22231500.17441529X-RAY DIFFRACTION93
4.3426-4.53950.2191640.17561480X-RAY DIFFRACTION92
4.5395-4.77790.20181660.16881522X-RAY DIFFRACTION94
4.7779-5.07590.20761760.17221512X-RAY DIFFRACTION94
5.0759-5.46550.21571880.18031508X-RAY DIFFRACTION94
5.4655-6.01130.23861650.19431515X-RAY DIFFRACTION93
6.0113-6.87160.251710.2041497X-RAY DIFFRACTION91
6.8716-8.62150.2271700.171533X-RAY DIFFRACTION92
8.6215-29.50080.20451650.17251585X-RAY DIFFRACTION90
Refinement TLS params.

Method: refined / Refine-ID: X-RAY DIFFRACTION

IDL11 (°2)L12 (°2)L13 (°2)L22 (°2)L23 (°2)L33 (°2)S11 (Å °)S12 (Å °)S13 (Å °)S21 (Å °)S22 (Å °)S23 (Å °)S31 (Å °)S32 (Å °)S33 (Å °)T11 (Å2)T12 (Å2)T13 (Å2)T22 (Å2)T23 (Å2)T33 (Å2)Origin x (Å)Origin y (Å)Origin z (Å)
12.07440.15890.26852.10490.71350.21381.1736-0.80870.85272.5658-1.37862.2344-0.1767-0.7504-0.09871.71740.07180.43191.6236-0.0461.67999.6346111.853119.4256
24.0147-3.9246-0.02414.0769-0.65891.86880.35480.5799-1.56570.81150.4421.53240.2-1.13320.34141.0233-0.54490.1481.06030.10661.764514.337865.742919.4159
31.3558-1.04740.04490.9251-0.58011.7551-0.2891-0.4906-0.58620.1569-0.3297-0.92120.90591.1955-2.1260.76140.3555-0.18251.11920.30741.12467.230771.416220.9835
42.23790.26451.41921.1750.69771.91650.1186-0.11711.2973-0.4303-0.1837-0.1339-0.9526-0.1328-0.04530.9237-0.08870.18750.47490.04750.916344.881124.83681.7113
52.05260.10510.14460.91160.38260.15010.14580.4312-0.942-0.0947-0.56671.6580.4609-0.61330.18621.0445-0.283-0.00351.0283-0.13480.946314.438474.639-5.5661
62.1309-0.00680.49320.0282-0.09250.5091-0.2547-0.186-1.5428-1.35920.2786-0.26790.83230.10490.11191.54010.14620.26830.9031-0.16391.531352.496850.0233-2.4507
71.99730.0553-0.11910.6057-1.01411.53650.56590.1519-0.3137-0.3167-1.0556-2.2272-0.01040.9782-0.27021.05140.24950.44431.20010.03491.73782.55592.2212-8.8689
81.3906-0.859-0.27630.7935-0.2521.56140.83890.16570.2923-1.0209-1.4779-1.54670.00950.6523-0.06560.844-0.03710.40861.47440.17751.530285.1536102.8163-11.9129
90.19650.1867-0.39982.09410.12040.8239-0.53370.031-1.5423-0.43620.0165-0.04940.87550.31890.17721.34890.16390.14450.7045-0.12141.620858.082654.3866-3.2055
101.33590.27150.18920.086-0.19561.41980.28230.2528-0.7325-0.0859-0.96641.94120.3839-0.9915-0.62090.6192-0.0845-0.0991.2293-0.30911.029511.078283.2297-6.552
111.2004-0.00061.00171.7757-0.35532.1627-0.14630.0760.80470.0273-0.1103-0.6187-1.05690.383-0.25020.9983-0.25610.06880.5460.06520.887852.5542124.27742.7742
120.0388-0.04390.15751.52080.85941.36960.4998-0.8288-0.42360.34960.0909-1.44650.62930.32814.54290.47310.4392-0.21962.18830.42271.568885.041384.606118.2396
133.8091-1.0505-0.78141.3979-0.35111.448-0.68480.0425-1.55780.28880.53550.14571.10880.0189-0.09221.21420.17570.06370.63560.15991.122249.427757.324922.1767
140.9071-0.51470.24340.5368-0.09211.89510.2234-0.30150.17410.82591.04623.9804-0.6157-1.8657-0.12921.6491-0.21260.13531.19020.40912.6599.192774.129818.0998
150.49020.34190.04980.2120.0388-0.0080.0861-1.18550.61490.363-0.84211.1553-0.0528-0.10330.3431.52290.31540.34311.44480.04511.524511.5047116.159919.1574
160.7788-0.706-0.04920.6497-0.00310.62010.0696-0.1256-0.0862-0.0708-0.3364-0.4092-0.16650.4229-1.24760.3838-0.34240.41670.8281-0.02480.892972.6655113.6031-3.458
172.51430.1244-0.16853.04980.5871.73740.0061-1.0664-0.09260.5993-0.2386-0.9009-0.00680.47690.00190.2024-0.1408-0.02490.78750.01870.666470.395595.214115.7005
180.4588-0.6040.0982.2821-0.53251.8093-0.3216-0.0780.51840.4989-0.1586-1.1876-0.40610.7872-0.00720.1993-0.1139-0.02690.3750.02290.516561.488499.54269.5716
194.8080.74231.27225.19820.49764.14850.4506-1.1945-0.09350.8805-0.76181.0566-0.5565-0.4063-0.02030.4495-0.09190.13860.5133-0.11680.550750.035106.555310.284
200.49550.29560.76851.07170.20492.488-0.0304-0.24750.0610.6098-0.5493-1.1474-0.53680.8307-0.13880.6107-0.2036-0.00660.487-0.02260.797867.3193108.71029.0032
210.72051.7109-0.05666.1909-0.73910.98740.018-0.4520.00711.2143-0.065-0.2736-0.00540.03070.06430.30740.0678-0.06590.5245-0.00240.383259.260194.595317.8604
220.28350.00760.32243.4235-0.81980.5764-0.159-0.18170.0548-0.59150.2293-0.48640.430.31610.12610.26380.0874-0.0230.58970.10890.409660.150682.692511.8279
232.8968-1.05990.5061.60750.72812.5324-0.16660.0808-0.683-0.35730.24070.34880.44280.0151-0.16050.5358-0.02510.04120.31940.02690.405835.684368.440921.3428
243.1947-3.39520.4825.56450.60940.7939-0.434-0.827-0.16480.02590.70270.2206-0.20780.16860.04330.37170.00540.10160.37660.07350.249532.935585.20826.3936
254.6532-1.0052-2.50384.9455-1.52012.2447-0.5635-0.9157-0.16880.2940.7282-0.2767-0.1703-1.3193-0.00520.27030.0626-0.06060.80020.02070.318618.35896.84323.7279
261.6068-0.76010.94231.2179-0.39440.5622-0.28450.2418-0.00970.14920.19910.1188-0.3184-0.5476-0.0480.2541-0.00020.04870.47720.04650.198429.323197.530918.9306
270.99220.6083-0.86893.4427-0.94444.3148-0.1513-0.14370.15010.0008-0.2614-0.5238-0.09360.9181-1.47560.01720.00120.02480.3182-0.06760.460940.443494.775320.7828
281.4505-0.74093.58476.5423-2.4848.9277-0.69040.51890.4384-0.5658-0.0602-1.01250.60170.4569-0.03250.50090.0246-0.00240.3353-0.00190.30437.39892.899411.0128
291.4092-0.40840.14624.55570.2230.5417-0.02880.2258-0.2106-0.31650.5739-0.0451-0.291-0.01880.03410.29080.02880.06190.31950.06570.184329.4864102.880813.6992
301.93240.8505-0.24980.4752-0.45141.6598-0.0272-0.37641.96490.87970.1767-0.1678-1.1065-0.3065-0.16380.93120.1109-0.05550.8985-0.23660.954935.2114123.700514.6502
312.15190.14070.27220.4277-0.69061.6744-0.1299-0.0455-0.24320.3825-0.16580.50130.7047-0.7070.08760.6137-0.16820.02510.40850.06950.296722.642480.620622.7109
326.2435-2.1733-0.0971.97670.23682.25340.03710.6828-0.0967-0.126-0.1759-0.08580.7491-0.1372-0.0640.3998-0.03830.02270.2552-0.01070.241738.481880.239614.6818
331.4887-0.01840.87110.857-0.86861.4152-0.53770.0305-0.08420.42380.4211-0.07270.61290.31640.46630.61760.230.07940.4110.10240.378345.559176.759326.4415
342.52271.2291-0.79865.7478-0.47343.5905-0.1094-0.11050.7131-0.03460.40470.9499-0.6243-0.84440.17150.63430.16730.05340.438-0.12810.432223.8723118.7449.7664
350.6128-0.13811.14483.66141.23182.670.15260.0593-0.1451-1.013-0.10410.5094-0.4714-0.0355-0.04290.3791-0.0038-0.07050.5365-0.040.298123.130496.4902-5.8569
360.70890.2599-0.31972.8843-0.99320.4189-0.38631.0623-0.6338-0.7662-0.7981.11090.6323-0.7022-0.37020.5774-0.0811-0.13140.7442-0.14610.452923.132383.4224-11.3389
370.36080.31650.44091.70150.45211.51540.31890.13390.23540.0887-0.10010.014-0.0633-0.4060.08570.27050.13560.06480.1507-0.03310.34434.5082105.56582.8024
383.3925-1.48711.20061.905-1.70731.5448-0.04470.1901-0.0379-0.2884-0.57250.09960.0903-0.1446-1.2320.38440.19770.16070.196-0.02740.405544.4056108.0556-2.3793
398.417-0.37135.34553.51931.48984.64-0.09411.67130.2386-1.76560.0061-1.8701-0.0210.7368-0.09420.8899-0.02710.24280.40450.02240.684845.8173100.6839-2.483
405.25343.0474-0.87018.2671-2.9713.9294-0.55750.0634-0.318-0.6619-0.43-0.6717-0.0415-0.3308-0.06740.7180.04780.03510.9284-0.06840.329719.875395.7554-19.6522
410.15810.01240.48220.187-0.2622.69440.04920.29370.3982-0.596-0.31040.1734-0.151-0.4767-0.17530.50580.19490.03980.26830.03970.409927.9587110.7331-1.4715
421.83150.29290.02923.84890.90431.0015-0.48670.3802-0.1609-0.2090.788-0.51650.0608-0.27480.07950.3102-0.01920.00550.3891-0.08360.220631.973590.8442-7.4967
433.7-0.32280.96391.29851.16173.59340.3701-0.063-0.30290.28220.04380.31220.9118-0.0093-0.00480.29430.01420.00930.2873-0.05290.293432.769386.16283.6712
442.6838-0.01512.57122.50071.31823.33170.31490.5831-0.87110.0572-0.00640.22240.99120.52041.39790.94810.16050.4070.4517-0.29740.89257.624263.0571-13.7248
455.56630.3944-3.70750.5398-0.49684.24420.0723-0.4527-1.08770.3627-0.4772-0.89610.09780.7302-0.010.84150.11990.10750.38660.01370.718453.515864.8841-1.2892
462.42931.52950.85243.7958-0.16642.1084-0.354-0.16980.13490.2304-0.69190.48960.3196-0.3969-0.05930.69640.25910.11870.7515-0.13050.472344.508265.1070.5924
473.06821.11021.27541.70040.96320.7277-0.62361.4804-0.3494-1.17670.5617-0.4066-0.03410.16210.06740.72860.13180.19770.6901-0.05880.457158.525279.9926-13.7023
482.00560.20330.91230.9491-0.18842.4772-0.01750.30230.5773-0.3284-0.5894-0.4820.06760.0072-1.02870.74490.32080.33670.77850.16460.806473.741988.6878-12.0699
490.7011.32690.66272.50851.25370.6284-0.4460.4596-0.3888-0.56710.09530.16080.40260.8624-0.52780.41830.13430.18770.6297-0.01010.583763.426292.4151-8.8487
504.16320.12190.64443.9034-0.3095.9519-0.0920.80460.4662-0.1242-0.19620.9479-0.0984-0.3505-0.01180.52980.02730.1530.33380.06760.447553.362490.7091-6.3182
510.1690.74110.0143.8293-0.58980.7442-0.20560.08370.21920.1780.0646-0.5961-1.0810.70530.09510.444-0.13240.05190.48130.01580.559864.494498.2274-4.529
521.2659-0.3064-0.88120.22880.41522.0434-0.24960.86380.80720.0566-0.5894-0.69-0.2212-0.506-0.02680.9118-0.06430.16690.73310.22521.072761.1728117.7313-8.5479
533.4174-3.03455.32442.861-4.89968.47050.2744-0.54040.8392-0.3062-0.31240.20850.7005-0.2139-0.00021.22470.04530.00210.5547-0.02810.564965.128368.20141.8873
540.97630.43091.13081.12180.44321.30110.23440.56890.0267-0.49860.1849-0.5605-0.15590.66181.97920.56160.39540.45910.82050.04110.749868.306576.3388-13.9303
553.7580.933-0.07221.2539-0.35421.40310.0835-0.72530.0035-0.3242-0.2289-0.30590.20240.2017-0.03410.4860.11980.090.401-0.0580.391151.877577.5863-1.1694
566.34410.7996-4.66240.1644-0.56633.55580.35530.5399-0.697-0.4898-0.17290.0433-0.21320.19330.06160.60050.09310.00630.2998-0.16860.569937.060566.6074-1.5037
572.7472-2.3492-1.13662.66161.16960.53030.0307-0.12260.4746-0.9739-0.1708-0.0027-0.1516-0.5086-0.12930.512-0.0933-0.06310.2559-0.10960.202742.194777.0195-8.8871
581.8167-0.19761.06047.18741.86961.1581-0.41961.0392-0.0854-1.18740.3928-0.6884-0.4380.18580.08890.82710.01470.0730.4956-0.14780.386248.12872.3466-17.8824
Refinement TLS group
IDRefine-IDRefine TLS-IDSelection details
1X-RAY DIFFRACTION1chain 'I' and (resid -73 through -54 )
2X-RAY DIFFRACTION2chain 'I' and (resid -53 through -44 )
3X-RAY DIFFRACTION3chain 'I' and (resid -43 through -14 )
4X-RAY DIFFRACTION4chain 'I' and (resid -13 through 16 )
5X-RAY DIFFRACTION5chain 'I' and (resid 17 through 36 )
6X-RAY DIFFRACTION6chain 'I' and (resid 37 through 46 )
7X-RAY DIFFRACTION7chain 'I' and (resid 47 through 73 )
8X-RAY DIFFRACTION8chain 'J' and (resid -73 through -54 )
9X-RAY DIFFRACTION9chain 'J' and (resid -53 through -34 )
10X-RAY DIFFRACTION10chain 'J' and (resid -33 through -14 )
11X-RAY DIFFRACTION11chain 'J' and (resid -13 through 16 )
12X-RAY DIFFRACTION12chain 'J' and (resid 17 through 26 )
13X-RAY DIFFRACTION13chain 'J' and (resid 27 through 46 )
14X-RAY DIFFRACTION14chain 'J' and (resid 47 through 56 )
15X-RAY DIFFRACTION15chain 'J' and (resid 57 through 73 )
16X-RAY DIFFRACTION16chain 'A' and (resid 39 through 56 )
17X-RAY DIFFRACTION17chain 'A' and (resid 57 through 77 )
18X-RAY DIFFRACTION18chain 'A' and (resid 78 through 120 )
19X-RAY DIFFRACTION19chain 'A' and (resid 121 through 134 )
20X-RAY DIFFRACTION20chain 'B' and (resid 25 through 49 )
21X-RAY DIFFRACTION21chain 'B' and (resid 50 through 75 )
22X-RAY DIFFRACTION22chain 'B' and (resid 76 through 102 )
23X-RAY DIFFRACTION23chain 'C' and (resid 15 through 44 )
24X-RAY DIFFRACTION24chain 'C' and (resid 45 through 72 )
25X-RAY DIFFRACTION25chain 'C' and (resid 73 through 79 )
26X-RAY DIFFRACTION26chain 'C' and (resid 80 through 89 )
27X-RAY DIFFRACTION27chain 'C' and (resid 90 through 96 )
28X-RAY DIFFRACTION28chain 'C' and (resid 97 through 101 )
29X-RAY DIFFRACTION29chain 'C' and (resid 102 through 111 )
30X-RAY DIFFRACTION30chain 'C' and (resid 112 through 120 )
31X-RAY DIFFRACTION31chain 'D' and (resid 28 through 52 )
32X-RAY DIFFRACTION32chain 'D' and (resid 53 through 81 )
33X-RAY DIFFRACTION33chain 'D' and (resid 82 through 121 )
34X-RAY DIFFRACTION34chain 'E' and (resid 39 through 56 )
35X-RAY DIFFRACTION35chain 'E' and (resid 57 through 78 )
36X-RAY DIFFRACTION36chain 'E' and (resid 79 through 85 )
37X-RAY DIFFRACTION37chain 'E' and (resid 86 through 120 )
38X-RAY DIFFRACTION38chain 'E' and (resid 121 through 130 )
39X-RAY DIFFRACTION39chain 'E' and (resid 131 through 135 )
40X-RAY DIFFRACTION40chain 'F' and (resid 19 through 24 )
41X-RAY DIFFRACTION41chain 'F' and (resid 25 through 49 )
42X-RAY DIFFRACTION42chain 'F' and (resid 50 through 82 )
43X-RAY DIFFRACTION43chain 'F' and (resid 83 through 102 )
44X-RAY DIFFRACTION44chain 'G' and (resid 14 through 26 )
45X-RAY DIFFRACTION45chain 'G' and (resid 27 through 36 )
46X-RAY DIFFRACTION46chain 'G' and (resid 37 through 46 )
47X-RAY DIFFRACTION47chain 'G' and (resid 47 through 72 )
48X-RAY DIFFRACTION48chain 'G' and (resid 73 through 80 )
49X-RAY DIFFRACTION49chain 'G' and (resid 81 through 89 )
50X-RAY DIFFRACTION50chain 'G' and (resid 90 through 101 )
51X-RAY DIFFRACTION51chain 'G' and (resid 102 through 111 )
52X-RAY DIFFRACTION52chain 'G' and (resid 112 through 119 )
53X-RAY DIFFRACTION53chain 'H' and (resid 29 through 34 )
54X-RAY DIFFRACTION54chain 'H' and (resid 35 through 52 )
55X-RAY DIFFRACTION55chain 'H' and (resid 53 through 81 )
56X-RAY DIFFRACTION56chain 'H' and (resid 82 through 87 )
57X-RAY DIFFRACTION57chain 'H' and (resid 88 through 100 )
58X-RAY DIFFRACTION58chain 'H' and (resid 101 through 121 )

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more