[English] 日本語

- PDB-2o01: The Structure of a plant photosystem I supercomplex at 3.4 Angstr... -
+
Open data
-
Basic information
Entry | Database: PDB / ID: 2o01 | ||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Title | The Structure of a plant photosystem I supercomplex at 3.4 Angstrom resolution | ||||||||||||
![]() |
| ||||||||||||
![]() | PHOTOSYNTHESIS / Membranal Super Complex | ||||||||||||
Function / homology | ![]() chloroplast photosystem I / response to low light intensity stimulus / plastoglobule / response to high light intensity / chloroplast thylakoid / photosynthesis, light harvesting in photosystem I / thylakoid / chloroplast thylakoid lumen / photosynthesis, light harvesting / chloroplast envelope ...chloroplast photosystem I / response to low light intensity stimulus / plastoglobule / response to high light intensity / chloroplast thylakoid / photosynthesis, light harvesting in photosystem I / thylakoid / chloroplast thylakoid lumen / photosynthesis, light harvesting / chloroplast envelope / photosystem I reaction center / photosystem I / photosynthetic electron transport in photosystem I / photosystem I / photosystem II / chlorophyll binding / chloroplast thylakoid membrane / photosynthesis / response to cold / chloroplast / phosphoprotein binding / 4 iron, 4 sulfur cluster binding / molecular adaptor activity / electron transfer activity / oxidoreductase activity / protein domain specific binding / mRNA binding / magnesium ion binding / metal ion binding / nucleus / plasma membrane Similarity search - Function | ||||||||||||
Biological species | ![]() ![]() ![]() ![]() ![]() | ||||||||||||
Method | ![]() ![]() ![]() | ||||||||||||
![]() | Amunts, A. / Drory, O. / Nelson, N. | ||||||||||||
![]() | ![]() Title: The structure of a plant photosystem I supercomplex at 3.4 A resolution. Authors: Amunts, A. / Drory, O. / Nelson, N. | ||||||||||||
History |
| ||||||||||||
Remark 650 | HELIX determination method: author determined | ||||||||||||
Remark 700 | SHEET determination method: author determined | ||||||||||||
Remark 750 | TURN determination method: author determined | ||||||||||||
Remark 999 | SEQUENCE Sequence for Chain K was modeled as ALA due to poor electron density, therefore alignment ...SEQUENCE Sequence for Chain K was modeled as ALA due to poor electron density, therefore alignment is unclear and residues in coordinates were labeled as UNK. Proper sequence is LGAKCDFIGSSTNLIMVTSTTLMLFAGRFGLAPSANRKATAGLRLEARDSGLQ TGDPAGFTLADTLACGTVGHIIGVGVVLGLKNIGAI |
-
Structure visualization
Structure viewer | Molecule: ![]() ![]() |
---|
-
Downloads & links
-
Download
PDBx/mmCIF format | ![]() | 810.1 KB | Display | ![]() |
---|---|---|---|---|
PDB format | ![]() | 646.4 KB | Display | ![]() |
PDBx/mmJSON format | ![]() | Tree view | ![]() | |
Others | ![]() |
-Validation report
Summary document | ![]() | 44.2 MB | Display | ![]() |
---|---|---|---|---|
Full document | ![]() | 45.4 MB | Display | |
Data in XML | ![]() | 307.5 KB | Display | |
Data in CIF | ![]() | 359.8 KB | Display | |
Arichive directory | ![]() ![]() | HTTPS FTP |
-Related structure data
Related structure data | ![]() 1qzvS S: Starting model for refinement |
---|---|
Similar structure data |
-
Links
-
Assembly
Deposited unit | ![]()
| ||||||||
---|---|---|---|---|---|---|---|---|---|
1 |
| ||||||||
Unit cell |
|
-
Components
-Photosystem I P700 chlorophyll a apoprotein ... , 2 types, 2 molecules AB
#1: Protein | Mass: 83669.664 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
---|---|
#2: Protein | Mass: 82226.617 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
-Protein , 6 types, 6 molecules CN1234
#3: Protein | Mass: 8860.276 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
---|---|
#13: Protein | Mass: 9767.049 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
#14: Protein | Mass: 20415.283 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() ![]() |
#15: Protein | Mass: 20580.225 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
#16: Protein | Mass: 17929.711 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() ![]() |
#17: Protein | Mass: 18561.234 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
-Photosystem I reaction center subunit ... , 9 types, 9 molecules DEFGHIJKL
#4: Protein | Mass: 15553.920 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
---|---|
#5: Protein | Mass: 7127.102 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() ![]() |
#6: Protein | Mass: 17299.033 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
#7: Protein | Mass: 10518.862 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
#8: Protein | Mass: 8143.354 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
#9: Protein/peptide | Mass: 3270.042 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
#10: Protein/peptide | Mass: 4845.679 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
#11: Protein/peptide | Mass: 3252.000 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() ![]() |
#12: Protein | Mass: 17479.225 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
-Non-polymers , 4 types, 178 molecules 






#18: Chemical | ChemComp-CLA / #19: Chemical | #20: Chemical | ChemComp-BCR / #21: Chemical | |
---|
-Details
Has protein modification | Y |
---|
-Experimental details
-Experiment
Experiment | Method: ![]() |
---|
-
Sample preparation
Crystal | Density Matthews: 4.15 Å3/Da / Density % sol: 70.33 % |
---|---|
Crystal grow | Temperature: 278 K / Method: vapor diffusion, sitting drop / pH: 6 Details: pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 278K |
-Data collection
Diffraction | Mean temperature: 100 K |
---|---|
Diffraction source | Source: ![]() ![]() ![]() |
Radiation | Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray |
Radiation wavelength | Wavelength: 0.875 Å / Relative weight: 1 |
Reflection | Resolution: 3.4→50 Å / Num. obs: 70551 / % possible obs: 91.1 % / Observed criterion σ(F): 3.4 / Observed criterion σ(I): 3.4 / Redundancy: 3.6 % / Rmerge(I) obs: 0.14 / Net I/σ(I): 16.41 |
Reflection shell | Resolution: 3.4→3.52 Å / Redundancy: 2.7 % / Rmerge(I) obs: 0.475 / Mean I/σ(I) obs: 3.4 / Num. unique all: 6034 / % possible all: 78.9 |
-
Processing
Software |
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Refinement | Method to determine structure: ![]() Starting model: PDB ENTRY 1QZV Resolution: 3.4→40 Å / Cor.coef. Fo:Fc: 0.778 / Cor.coef. Fo:Fc free: 0.707 / SU B: 34.519 / SU ML: 0.625 / Cross valid method: THROUGHOUT / σ(F): 0 / ESU R Free: 0.975 / Stereochemistry target values: MAXIMUM LIKELIHOOD / Details: HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Solvent computation | Ion probe radii: 0.8 Å / Shrinkage radii: 0.8 Å / VDW probe radii: 1.4 Å / Solvent model: MASK | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Displacement parameters | Biso mean: 44.13 Å2
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Refinement step | Cycle: LAST / Resolution: 3.4→40 Å
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Refine LS restraints |
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
LS refinement shell | Resolution: 3.4→3.488 Å / Total num. of bins used: 20
|