Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help

2JR8

Solution structure of Manduca sexta moricin

Summary for 2JR8
Entry DOI10.2210/pdb2jr8/pdb
NMR InformationBMRB: 15323
DescriptorAntimicrobial peptide moricin (1 entity in total)
Functional Keywordsantimicrobial peptide, antimicrobial protein
Total number of polymer chains1
Total formula weight4551.54
Authors
Gong, Y.,Dai, H.,Rayaprolu, S.,Huang, R.,Prakash, O.,Jiang, H. (deposition date: 2007-06-21, release date: 2008-03-25, Last modification date: 2024-05-08)
Primary citationDai, H.,Rayaprolu, S.,Gong, Y.,Huang, R.,Prakash, O.,Jiang, H.
Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin.
J.Pept.Sci., 14:855-863, 2008
Cited by
PubMed Abstract: In response to wounding or infection, insects produce a battery of antimicrobial peptides (AMPs) and other defense molecules to kill the invading pathogens. To study their structures, functions, and transcriptional regulation, we synthesized Manduca sexta moricin, a 42-residue peptide (GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH, 4539 Da). The compound exhibited potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentration of 1.4 microM. The mRNA levels of M. sexta moricin increased substantially in fat body and hemocytes after the larvae were challenged with bacterial cells. We determined the solution structure of this AMP by two-dimensional 1H-1H -nuclear magnetic resonance spectroscopy. The tertiary structure is composed of an eight-turn alpha-helix spanning almost the entire peptide. Insights of relationships between the structure and function are also presented.
PubMed: 18265434
DOI: 10.1002/psc.1016
PDB entries with the same primary citation
Experimental method
SOLUTION NMR
Structure validation

258222

PDB entries from 2026-08-19

PDB statisticsPDBj update infoContact PDBjnumon