6IBG
Bacteriophage G20c portal protein crystal structure for construct with intact N-terminus
Experimental procedure
| Experimental method | SINGLE WAVELENGTH |
| Source type | SYNCHROTRON |
| Source details | DIAMOND BEAMLINE I04-1 |
| Synchrotron site | Diamond |
| Beamline | I04-1 |
| Temperature [K] | 120 |
| Detector technology | PIXEL |
| Collection date | 2016-06-19 |
| Detector | DECTRIS PILATUS 6M-F |
| Wavelength(s) | 0.92819 |
| Spacegroup name | I 4 |
| Unit cell lengths | 159.081, 159.081, 116.913 |
| Unit cell angles | 90.00, 90.00, 90.00 |
Refinement procedure
| Resolution | 10.000 - 1.950 |
| R-factor | 0.15879 |
| Rwork | 0.158 |
| R-free | 0.21613 |
| RMSD bond length | 0.006 |
| RMSD bond angle | 1.367 |
| Data reduction software | DIALS |
| Data scaling software | Aimless |
| Phasing software | MOLREP |
| Refinement software | REFMAC (5.8.0238) |
Data quality characteristics
| Overall | Outer shell | |
| Low resolution limit [Å] | 94.200 | 1.980 |
| High resolution limit [Å] | 1.950 | 1.950 |
| Rmerge | 0.103 | 1.199 |
| Number of reflections | 105514 | 7752 |
| <I/σ(I)> | 6.2 | 0.6 |
| Completeness [%] | 99.8 | 99.9 |
| Redundancy | 6.8 | 7 |
| CC(1/2) | 0.999 | 0.626 |
Crystallization Conditions
| crystal ID | method | pH | temperature | details |
| 1 | VAPOR DIFFUSION, SITTING DROP | 293 | 13.3mg/ml protein, 2mg/ml 42-amino acid peptide kdgykfelaeerpsklkheesvmslveddftdlelanrafsa, 20 mM Tris-HCl pH 7.5, 1 M NaCl, 5 % v/v glycerol. Reservoir: 40 % MPD v/v, 200 mM NaH2PO4 |
