Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help

Obtain the PDBID + ChainID (auth_asym_id) of the entries containing the sequence \

This page is also available in: 日本語

Search from here

SELECT b.pdbid, e.pdbx_strand_id FROM entity_poly e
LEFT JOIN brief_summary b ON e.pdbid=b.pdbid
WHERE e.pdbx_seq_one_letter_code LIKE '%TVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGR%'
AND b.biol_species LIKE '%Glycine max%'
  • To use brief_summary table is convenient because the category that biological resource information is described is vary according to get the molecule.
  • If ChainID is not necessary, it is enough to refer brief_summary.aaseq, which includes all the sequence information in each PDB entry.
Element Contents
entity_src_nat The biological resource information when the molecule is derived from the species directly.
entity_src_nat The biological resource information when the molecule is derived by using another host species.
pdbx_entity_src_syn The biological resource information when the molecule is synthesized.
brief_summary.biol_species The value that is concatenated all the species name in each PDB entry.
entity_poly.pdbx_seq_one_letter_code The amino acid or nucleic acid sequence in each PDB entry.
brief_summary.aaseq The value that is concatenated all the sequence in each PDB entry.

Created: 2018-06-13 (last edited: more than 1 year ago)2018-07-09

258735

PDB entries from 2026-08-26

PDB statisticsPDBj update infoContact PDBjnumon