[English] 日本語
Yorodumi
- PDB-8ro1: Structure of the C. elegans Intron Lariat Spliceosome double-prim... -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 8ro1
TitleStructure of the C. elegans Intron Lariat Spliceosome double-primed for disassembly (ILS'')
Components
  • (CWF19-like protein ...) x 2
  • (Peptidyl-prolyl cis-trans ...) x 2
  • (Pre-mRNA-splicing factor ...) x 6
  • (Probable small nuclear ribonucleoprotein ...) x 4
  • (Small nuclear ribonucleoprotein Sm ...) x 2
  • (WD_REPEATS_REGION domain-containing ...) x 3
  • Cell division cycle 5-like protein
  • Coiled-coil domain-containing protein 12
  • GCF C-terminal domain-containing protein
  • Intron lariat RNA
  • Intron-binding protein aquarius
  • Pre-mRNA-processing factor 19
  • Probable U2 small nuclear ribonucleoprotein A'
  • Probable small nuclear ribonucleoprotein-associated protein B
  • Protein BUD31 homolog
  • Protein isy-1
  • RRM domain-containing protein
  • Replication stress response regulator SDE2
  • Septin and tuftelin-interacting protein 1 homolog
  • Spliceosome-associated protein CWC15 homolog
  • TPR_REGION domain-containing protein
  • Tr-type G domain-containing protein
  • U2 snRNA
  • U5 snRNA
  • U6 snRNA
  • Uncharacterized protein T27F2.1
KeywordsSPLICING / pre-mRNA splicing / intron lariat spliceosome / gene expression / spliceosome
Function / homology
Function and homology information


feminization of hermaphroditic germ-line / molting cycle / RNA lariat debranching enzyme activator activity / regulation of primary miRNA processing / SLBP independent Processing of Histone Pre-mRNAs / snRNP Assembly / SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs / Transport of Mature mRNA derived from an Intron-Containing Transcript / mRNA Splicing - Minor Pathway / Formation of TC-NER Pre-Incision Complex ...feminization of hermaphroditic germ-line / molting cycle / RNA lariat debranching enzyme activator activity / regulation of primary miRNA processing / SLBP independent Processing of Histone Pre-mRNAs / snRNP Assembly / SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs / Transport of Mature mRNA derived from an Intron-Containing Transcript / mRNA Splicing - Minor Pathway / Formation of TC-NER Pre-Incision Complex / Dual incision in TC-NER / Gap-filling DNA repair synthesis and ligation in TC-NER / mRNA Splicing - Major Pathway / Downregulation of SMAD2/3:SMAD4 transcriptional activity / germline cell cycle switching, mitotic to meiotic cell cycle / mRNA 3'-end processing / RNA Polymerase II Transcription Termination / vulval development / nematode larval development / egg-laying behavior / post-spliceosomal complex / spliceosomal complex disassembly / U2-type post-mRNA release spliceosomal complex / spliceosomal conformational changes to generate catalytic conformation / post-mRNA release spliceosomal complex / generation of catalytic spliceosome for first transesterification step / apoptotic DNA fragmentation / nuclear mRNA surveillance / nuclease activity / U12-type spliceosomal complex / U2-type catalytic step 1 spliceosome / pre-mRNA binding / pICln-Sm protein complex / RNA splicing, via transesterification reactions / embryo development ending in birth or egg hatching / SMN-Sm protein complex / spliceosomal tri-snRNP complex / P granule / snRNP binding / commitment complex / mRNA cis splicing, via spliceosome / U2-type catalytic step 2 spliceosome / U2-type spliceosomal complex / locomotion / U1 snRNP / U2 snRNP / U4 snRNP / U2-type prespliceosome / cyclosporin A binding / generation of catalytic spliceosome for second transesterification step / precatalytic spliceosome / mRNA 3'-splice site recognition / uterus development / germ cell development / spliceosomal tri-snRNP complex assembly / Prp19 complex / U5 snRNP / U5 snRNA binding / pre-mRNA intronic binding / spliceosomal snRNP assembly / U6 snRNA binding / U2 snRNA binding / protein K63-linked ubiquitination / U1 snRNA binding / U4/U6 x U5 tri-snRNP complex / catalytic step 2 spliceosome / RNA splicing / antiviral innate immune response / helicase activity / peptidylprolyl isomerase / peptidyl-prolyl cis-trans isomerase activity / RNA polymerase II transcription regulatory region sequence-specific DNA binding / spliceosomal complex / mRNA splicing, via spliceosome / RING-type E3 ubiquitin transferase / mRNA processing / metallopeptidase activity / rRNA processing / ubiquitin-protein transferase activity / ubiquitin protein ligase activity / protein folding / regulation of gene expression / nucleic acid binding / DNA-binding transcription factor activity, RNA polymerase II-specific / cell differentiation / RNA helicase activity / RNA helicase / DNA repair / mRNA binding / GTPase activity / apoptotic process / regulation of transcription by RNA polymerase II / positive regulation of DNA-templated transcription / GTP binding / ATP hydrolysis activity / DNA binding / RNA binding / zinc ion binding / nucleoplasm / ATP binding
Similarity search - Function
Intron Large complex component GCFC2-like / Septin and tuftelin interacting protein / Tuftelin interacting protein, N-terminal domain / Tuftelin interacting protein N terminal / GCF, C-terminal / GC-rich sequence DNA-binding factor-like protein / mRNA splicing factor Cwf18-like / : / TFP11/STIP/Ntr1 / : ...Intron Large complex component GCFC2-like / Septin and tuftelin interacting protein / Tuftelin interacting protein, N-terminal domain / Tuftelin interacting protein N terminal / GCF, C-terminal / GC-rich sequence DNA-binding factor-like protein / mRNA splicing factor Cwf18-like / : / TFP11/STIP/Ntr1 / : / cwf18 pre-mRNA splicing factor / Nineteen complex-related protein 2 / Splicing regulator SDE2, SDE2 domain / Cwf19-like protein, C-terminal domain-2 / Cwf19-like, C-terminal domain-1 / Cwf19-like protein / Protein similar to CwfJ C-terminus 2 / Protein similar to CwfJ C-terminal / DHX15, DEXH-box helicase domain / Pre-mRNA-splicing factor Isy1 / Pre-mRNA-splicing factor Isy1 superfamily / Isy1-like splicing family / Prp19 WD40 domain / : / : / Intron-binding protein aquarius, beta-barrel / Intron-binding protein aquarius insert domain / Peptidyl-prolyl cis-trans isomerase E / Peptidyl-prolyl cis-trans isomerase E, RNA recognition motif / : / RBM22 CCCH zinc finger domain / Pre-mRNA-splicing factor SPF27 / Breast carcinoma amplified sequence 2 (BCAS2) / CWF11 family / Intron-binding protein aquarius, N-terminal / Intron-binding protein aquarius N-terminal / mRNA splicing factor SYF2 / SYF2 splicing factor / Helix hairpin bin domain superfamily / : / Replication stress response SDE2 C-terminal / G-patch domain / G-patch domain profile. / Pre-mRNA-processing factor 17 / Pre-mRNA-splicing factor 19 / Pre-mRNA-processing factor 19 / : / Prp19/Pso4-like / : / Pre-mRNA-splicing factor SYF1 middle HAT repeat / G10 protein signature 2. / G-patch domain / glycine rich nucleic binding domain / Cyclophilin-type peptidyl-prolyl cis-trans isomerase, cyclophilin A-like / BUD31/G10-related, conserved site / : / G10 protein signature 1. / : / Myb-like domain profile. / : / : / U-box domain / STL11, N-terminal / Pre-mRNA-splicing factor Syf1/CRNKL1 C-terminal HAT repeat / SKI-interacting protein SKIP, SNW domain / SKI-interacting protein, SKIP / : / SKIP/SNW domain / Pre-mRNA-splicing factor Syf1/CNRKL1 N-terminal HAT repeat / Pre-mRNA-splicing factor Cwf15/Cwc15 / Cwf15/Cwc15 cell cycle control protein / DNA2/NAM7 helicase, helicase domain / AAA domain / WD repeat Prp46/PLRG1-like / Pre-mRNA-splicing factor Cwc2/Slt11 / : / G10 protein / Pre-mRNA splicing factor component Cdc5p/Cef1, C-terminal / : / : / Pre-mRNA-splicing factor BUD31 / pre-mRNA splicing factor component / DNA2/NAM7-like helicase / : / Myb-like DNA-binding domain / U2 small nuclear ribonucleoprotein A' / Small nuclear ribonucleoprotein D1 / HIT-like superfamily / U-box domain profile. / Zinc finger, CCCH-type superfamily / Modified RING finger domain / U-box domain / Leucine-rich repeat / zinc finger / 116kDa U5 small nuclear ribonucleoprotein component, N-terminal / 116kDa U5 small nuclear ribonucleoprotein component, C-terminal / Snu114, GTP-binding domain / Pre-mRNA-splicing factor Syf1-like / 116 kDa U5 small nuclear ribonucleoprotein component N-terminus / Small nuclear ribonucleoprotein Sm D2
Similarity search - Domain/homology
GUANOSINE-5'-TRIPHOSPHATE / INOSITOL HEXAKISPHOSPHATE / RNA / RNA (> 10) / RNA (> 100) / Small nuclear ribonucleoprotein Sm D1 / Replication stress response regulator SDE2 / GCF C-terminal domain-containing protein / Pleiotropic regulator 1 / Cell division cycle 5-like protein ...GUANOSINE-5'-TRIPHOSPHATE / INOSITOL HEXAKISPHOSPHATE / RNA / RNA (> 10) / RNA (> 100) / Small nuclear ribonucleoprotein Sm D1 / Replication stress response regulator SDE2 / GCF C-terminal domain-containing protein / Pleiotropic regulator 1 / Cell division cycle 5-like protein / CWF19-like protein 1 homolog / Pre-mRNA-splicing factor Syf1/CRNKL1-like C-terminal HAT-repeats domain-containing protein / Pre-mRNA-processing factor 17 / Spliceosome-associated protein CWC15 homolog / Protein BUD31 homolog / Pre-mRNA-splicing factor 8 homolog / Probable small nuclear ribonucleoprotein F / Pre-mRNA-splicing factor SYF1 / Probable small nuclear ribonucleoprotein-associated protein B / Pre-mRNA-splicing factor syf-2 / Pre-mRNA-processing factor 19 / CWF19-like protein 2 homolog / Small nuclear ribonucleoprotein Sm D3 / Septin and tuftelin-interacting protein 1 homolog / Peptidyl-prolyl cis-trans isomerase / Probable small nuclear ribonucleoprotein Sm D2 / U5 small nuclear ribonucleoprotein 40 kDa protein / Protein isy-1 / Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 / RRM domain-containing protein / Pre-mRNA-splicing factor RBM22 / Pre-mRNA-splicing factor SPF27 / Uncharacterized protein T27F2.1 / Tr-type G domain-containing protein / Coiled-coil domain-containing protein 12 / Probable U2 small nuclear ribonucleoprotein A' / Probable small nuclear ribonucleoprotein G / Intron-binding protein aquarius / Peptidyl-prolyl cis-trans isomerase E / Probable small nuclear ribonucleoprotein E
Similarity search - Component
Biological speciesCaenorhabditis elegans (invertebrata)
MethodELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 3 Å
AuthorsVorlaender, M.K. / Rothe, P. / Plaschka, C.
Funding supportEuropean Union, 1items
OrganizationGrant numberCountry
European Research Council (ERC)European Union
CitationJournal: Nature / Year: 2024
Title: Mechanism for the initiation of spliceosome disassembly.
Authors: Matthias K Vorländer / Patricia Rothe / Justus Kleifeld / Eric D Cormack / Lalitha Veleti / Daria Riabov-Bassat / Laura Fin / Alex W Phillips / Luisa Cochella / Clemens Plaschka /
Abstract: Precursor-mRNA (pre-mRNA) splicing requires the assembly, remodelling and disassembly of the multi-megadalton ribonucleoprotein complex called the spliceosome. Recent studies have shed light on ...Precursor-mRNA (pre-mRNA) splicing requires the assembly, remodelling and disassembly of the multi-megadalton ribonucleoprotein complex called the spliceosome. Recent studies have shed light on spliceosome assembly and remodelling for catalysis, but the mechanism of disassembly remains unclear. Here we report cryo-electron microscopy structures of nematode and human terminal intron lariat spliceosomes along with biochemical and genetic data. Our results uncover how four disassembly factors and the conserved RNA helicase DHX15 initiate spliceosome disassembly. The disassembly factors probe large inner and outer spliceosome surfaces to detect the release of ligated mRNA. Two of these factors, TFIP11 and C19L1, and three general spliceosome subunits, SYF1, SYF2 and SDE2, then dock and activate DHX15 on the catalytic U6 snRNA to initiate disassembly. U6 therefore controls both the start and end of pre-mRNA splicing. Taken together, our results explain the molecular basis of the initiation of canonical spliceosome disassembly and provide a framework to understand general spliceosomal RNA helicase control and the discard of aberrant spliceosomes.
History
DepositionJan 11, 2024Deposition site: PDBE / Processing site: PDBE
Revision 1.0Aug 7, 2024Provider: repository / Type: Initial release
Revision 1.1Aug 21, 2024Group: Data collection / Database references / Category: citation / citation_author / em_admin
Item: _citation.journal_volume / _citation.page_first ..._citation.journal_volume / _citation.page_first / _citation.page_last / _citation_author.identifier_ORCID / _citation_author.name / _em_admin.last_update

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
2: U2 snRNA
5: U5 snRNA
6: U6 snRNA
A: Pre-mRNA-splicing factor 8 homolog
C: Tr-type G domain-containing protein
D: Protein isy-1
DX: Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15
E: WD_REPEATS_REGION domain-containing protein
I: Pre-mRNA-splicing factor SYF1
IN: Intron lariat RNA
J: TPR_REGION domain-containing protein
K: Pre-mRNA-splicing factor SPF27
L: Cell division cycle 5-like protein
L1: CWF19-like protein 1 homolog
L2: CWF19-like protein 2 homolog
M: Pre-mRNA-splicing factor syf-2
N: Protein BUD31 homolog
O: Pre-mRNA-splicing factor RBM22
P: Spliceosome-associated protein CWC15 homolog
PX: GCF C-terminal domain-containing protein
Q: Intron-binding protein aquarius
R: Uncharacterized protein T27F2.1
S: Peptidyl-prolyl cis-trans isomerase
T: WD_REPEATS_REGION domain-containing protein
TF: Septin and tuftelin-interacting protein 1 homolog
W: WD_REPEATS_REGION domain-containing protein
X: Replication stress response regulator SDE2
Z: Coiled-coil domain-containing protein 12
a: Small nuclear ribonucleoprotein Sm D3
b: Probable small nuclear ribonucleoprotein-associated protein B
c: Small nuclear ribonucleoprotein Sm D1
d: Probable small nuclear ribonucleoprotein Sm D2
e: Probable small nuclear ribonucleoprotein E
f: Probable small nuclear ribonucleoprotein F
g: Probable small nuclear ribonucleoprotein G
h: Small nuclear ribonucleoprotein Sm D3
i: Probable small nuclear ribonucleoprotein-associated protein B
j: Small nuclear ribonucleoprotein Sm D1
k: Probable small nuclear ribonucleoprotein Sm D2
l: Probable small nuclear ribonucleoprotein E
m: Probable small nuclear ribonucleoprotein F
n: Probable small nuclear ribonucleoprotein G
o: Probable U2 small nuclear ribonucleoprotein A'
p: RRM domain-containing protein
q: Pre-mRNA-processing factor 19
r: Pre-mRNA-processing factor 19
s: Pre-mRNA-processing factor 19
t: Pre-mRNA-processing factor 19
y: Peptidyl-prolyl cis-trans isomerase E
hetero molecules


Theoretical massNumber of molelcules
Total (without water)2,289,68566
Polymers2,287,21349
Non-polymers2,47117
Water00
1


  • Idetical with deposited unit
  • defined by author&software
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1

-
Components

-
RNA chain , 4 types, 4 molecules 256IN

#1: RNA chain U2 snRNA


Mass: 68422.445 Da / Num. of mol.: 1 / Source method: isolated from a natural source
Details: Full sequence: AUCGCUUCUUCGGCUUAUUAGCUAAGAUCAAAGUGUAGUAUCUGUUCUUAUCGUAUUAACCUACGGUAUACACUCGAAUGAGUGUAAUAAAGGUUAUAUGAUUUUUGGAACCUAGGGAAGACUCGGGGCUUGCUCCGACUUCCCAAGGGUCGUCCUGGCGUUGCACUGCUGCCGGGCUCGGCCCAGUCCCC
Source: (natural) Caenorhabditis elegans (invertebrata)
#2: RNA chain U5 snRNA


Mass: 35826.145 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata)
#3: RNA chain U6 snRNA


Mass: 32483.355 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Caenorhabditis elegans (invertebrata) / Production host: Caenorhabditis elegans (invertebrata)
#10: RNA chain Intron lariat RNA


Mass: 10348.173 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata)

-
Pre-mRNA-splicing factor ... , 6 types, 6 molecules ADXIKMO

#4: Protein Pre-mRNA-splicing factor 8 homolog


Mass: 272396.156 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: P34369
#7: Protein Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 / DEAH box protein 15


Mass: 84495.477 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q20875, RNA helicase
#9: Protein Pre-mRNA-splicing factor SYF1


Mass: 99675.094 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: P91175
#12: Protein Pre-mRNA-splicing factor SPF27


Mass: 27679.885 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q22417
#16: Protein Pre-mRNA-splicing factor syf-2


Mass: 27719.021 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q09385
#18: Protein Pre-mRNA-splicing factor RBM22 / RNA-binding motif protein 22


Mass: 45902.750 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q22412

-
Protein , 16 types, 20 molecules CDJLNPPXQRTFXZbiopqrst

#5: Protein Tr-type G domain-containing protein


Mass: 110612.859 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q23463
#6: Protein Protein isy-1


Mass: 31326.172 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q20716
#11: Protein TPR_REGION domain-containing protein


Mass: 88116.000 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: O16376
#13: Protein Cell division cycle 5-like protein


Mass: 85843.469 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: G5EFC4
#17: Protein Protein BUD31 homolog / Protein G10 homolog


Mass: 17153.879 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: P34313
#19: Protein Spliceosome-associated protein CWC15 homolog


Mass: 26154.846 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: O45766
#20: Protein GCF C-terminal domain-containing protein


Mass: 94244.891 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: G5ECH1
#21: Protein Intron-binding protein aquarius


Mass: 170397.688 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q9U1Q7
#22: Protein Uncharacterized protein T27F2.1


Mass: 60303.516 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q22836
#25: Protein Septin and tuftelin-interacting protein 1 homolog / STIP-1


Mass: 94421.539 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q17784
#27: Protein Replication stress response regulator SDE2


Mass: 57466.109 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: G5EC45
#28: Protein Coiled-coil domain-containing protein 12


Mass: 8135.504 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q95XJ1
#30: Protein Probable small nuclear ribonucleoprotein-associated protein B / snRNP-B / Sm protein B / Sm-B / SmB


Mass: 16768.627 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: P91918
#36: Protein Probable U2 small nuclear ribonucleoprotein A' / U2 snRNP A' / Masculinization of germline protein 2 / Spliceosome-associated protein mog-2


Mass: 28905.900 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q9BLB6
#37: Protein RRM domain-containing protein


Mass: 24881.344 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q21323
#38: Protein
Pre-mRNA-processing factor 19 / PRP19/PSO4 homolog / RING-type E3 ubiquitin transferase PRP19


Mass: 53272.633 Da / Num. of mol.: 4 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata)
References: UniProt: Q10051, RING-type E3 ubiquitin transferase

-
WD REPEATS REGION domain-containing ... , 3 types, 3 molecules ETW

#8: Protein WD_REPEATS_REGION domain-containing protein


Mass: 36865.559 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q19211
#24: Protein WD_REPEATS_REGION domain-containing protein


Mass: 54766.215 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: G5EEL2
#26: Protein WD_REPEATS_REGION domain-containing protein


Mass: 65385.664 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: O44729

-
CWF19-like protein ... , 2 types, 2 molecules L1L2

#14: Protein CWF19-like protein 1 homolog


Mass: 59034.898 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: O16216
#15: Protein CWF19-like protein 2 homolog


Mass: 53269.211 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q10946

-
Peptidyl-prolyl cis-trans ... , 2 types, 2 molecules Sy

#23: Protein Peptidyl-prolyl cis-trans isomerase / PPIase


Mass: 18547.002 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q18445, peptidylprolyl isomerase
#39: Protein Peptidyl-prolyl cis-trans isomerase E / PPIase E


Mass: 8825.046 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q9U2S6, peptidylprolyl isomerase

-
Small nuclear ribonucleoprotein Sm ... , 2 types, 4 molecules ahcj

#29: Protein Small nuclear ribonucleoprotein Sm D3 / Sm-D3 / snRNP core protein D3


Mass: 14836.212 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q17348
#31: Protein Small nuclear ribonucleoprotein Sm D1 / snRNP core protein D1


Mass: 13724.070 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: E3LR34

-
Probable small nuclear ribonucleoprotein ... , 4 types, 8 molecules dkelfmgn

#32: Protein Probable small nuclear ribonucleoprotein Sm D2 / Sm-D2 / snRNP core protein D2


Mass: 13291.529 Da / Num. of mol.: 2 / Source method: isolated from a natural source
Details: MSAQAKPRSEMTAEELAAKEDEEFNVGPLSILTNSVKNNHQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKTGKGKKKAKSVAKDRFISKMFLRGDSVILVVKNPLAQAE
Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q18786
#33: Protein Probable small nuclear ribonucleoprotein E / snRNP-E / Sm protein E / Sm-E / SmE


Mass: 10625.318 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q9XTU6
#34: Protein Probable small nuclear ribonucleoprotein F / snRNP-F / Sm protein F / Sm-F / SmF


Mass: 9256.534 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: P34659
#35: Protein Probable small nuclear ribonucleoprotein G / snRNP-G / Sm protein G / Sm-G / SmG


Mass: 8756.209 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Caenorhabditis elegans (invertebrata) / References: UniProt: Q9N4G9

-
Non-polymers , 4 types, 17 molecules

#40: Chemical
ChemComp-MG / MAGNESIUM ION


Mass: 24.305 Da / Num. of mol.: 7 / Source method: obtained synthetically / Formula: Mg
#41: Chemical ChemComp-IHP / INOSITOL HEXAKISPHOSPHATE / MYO-INOSITOL HEXAKISPHOSPHATE / INOSITOL 1,2,3,4,5,6-HEXAKISPHOSPHATE


Mass: 660.035 Da / Num. of mol.: 2 / Source method: obtained synthetically / Formula: C6H18O24P6
#42: Chemical ChemComp-GTP / GUANOSINE-5'-TRIPHOSPHATE


Mass: 523.180 Da / Num. of mol.: 1 / Source method: obtained synthetically / Formula: C10H16N5O14P3 / Comment: GTP, energy-carrying molecule*YM
#43: Chemical
ChemComp-ZN / ZINC ION


Mass: 65.409 Da / Num. of mol.: 7 / Source method: obtained synthetically / Formula: Zn

-
Details

Has ligand of interestN

-
Experimental details

-
Experiment

ExperimentMethod: ELECTRON MICROSCOPY
EM experimentAggregation state: PARTICLE / 3D reconstruction method: single particle reconstruction

-
Sample preparation

ComponentName: Intron lariat spliceosome (ILS'') / Type: COMPLEX / Entity ID: #1-#39 / Source: NATURAL
Source (natural)Organism: Caenorhabditis elegans (invertebrata)
Buffer solutionpH: 7.9
SpecimenEmbedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES
VitrificationCryogen name: ETHANE

-
Electron microscopy imaging

Experimental equipment
Model: Titan Krios / Image courtesy: FEI Company
MicroscopyModel: FEI TITAN KRIOS
Electron gunElectron source: FIELD EMISSION GUN / Accelerating voltage: 300 kV / Illumination mode: FLOOD BEAM
Electron lensMode: BRIGHT FIELD / Nominal defocus max: 2000 nm / Nominal defocus min: 750 nm
Image recordingElectron dose: 60 e/Å2 / Film or detector model: GATAN K3 (6k x 4k)

-
Processing

CTF correctionType: PHASE FLIPPING AND AMPLITUDE CORRECTION
3D reconstructionResolution: 3 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 247908 / Symmetry type: POINT

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more