[English] 日本語
Yorodumi
- PDB-7pb8: Crystal structure of the CENP-OPQUR complex -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 7pb8
TitleCrystal structure of the CENP-OPQUR complex
Components(Centromere protein ...) x 5
KeywordsCELL CYCLE / Inner kinetochore
Function / homology
Function and homology information


Mis6-Sim4 complex / positive regulation of protein localization to kinetochore / metaphase chromosome alignment / chordate embryonic development / CENP-A containing chromatin assembly / negative regulation of epithelial cell apoptotic process / inner kinetochore / Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal / Deposition of new CENPA-containing nucleosomes at the centromere / Mitotic Prometaphase ...Mis6-Sim4 complex / positive regulation of protein localization to kinetochore / metaphase chromosome alignment / chordate embryonic development / CENP-A containing chromatin assembly / negative regulation of epithelial cell apoptotic process / inner kinetochore / Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal / Deposition of new CENPA-containing nucleosomes at the centromere / Mitotic Prometaphase / EML4 and NUDC in mitotic spindle formation / NRIF signals cell death from the nucleus / Resolution of Sister Chromatid Cohesion / positive regulation of epithelial cell proliferation / chromosome segregation / RHO GTPases Activate Formins / centriolar satellite / Separation of Sister Chromatids / actin cytoskeleton / cell adhesion / nuclear body / cell division / apoptotic process / regulation of DNA-templated transcription / nucleolus / signal transduction / nucleoplasm / membrane / nucleus / cytoplasm / cytosol
Similarity search - Function
Centromere protein R / Centromere protein Q / Centromere protein P / Kinetochore component, CENP-R / CENP-Q, a CENPA-CAD centromere complex subunit / CENP-A-nucleosome distal (CAD) centromere subunit, CENP-P / Centromere protein U / CENP-A nucleosome associated complex (NAC) subunit / Centromere protein O / Cenp-O kinetochore centromere component
Similarity search - Domain/homology
Centromere protein R / Centromere protein P / Centromere protein U / Centromere protein Q / Centromere protein O
Similarity search - Component
Biological speciesHomo sapiens (human)
MethodX-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 3.68 Å
AuthorsBellini, D. / Yatskevich, S. / Muir, K.W. / Barford, D.
Funding support United Kingdom, 1items
OrganizationGrant numberCountry
Medical Research Council (MRC, United Kingdom) United Kingdom
CitationJournal: Science / Year: 2022
Title: Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
Authors: Stanislau Yatskevich / Kyle W Muir / Dom Bellini / Ziguo Zhang / Jing Yang / Thomas Tischer / Masa Predin / Tom Dendooven / Stephen H McLaughlin / David Barford /
Abstract: Kinetochores assemble onto specialized centromeric CENP-A (centromere protein A) nucleosomes (CENP-A) to mediate attachments between chromosomes and the mitotic spindle. We describe cryo-electron ...Kinetochores assemble onto specialized centromeric CENP-A (centromere protein A) nucleosomes (CENP-A) to mediate attachments between chromosomes and the mitotic spindle. We describe cryo-electron microscopy structures of the human inner kinetochore constitutive centromere associated network (CCAN) complex bound to CENP-A reconstituted onto α-satellite DNA. CCAN forms edge-on contacts with CENP-A, and a linker DNA segment of the α-satellite repeat emerges from the fully wrapped end of the nucleosome to thread through the central CENP-LN channel that tightly grips the DNA. The CENP-TWSX histone-fold module further augments DNA binding and partially wraps the linker DNA in a manner reminiscent of canonical nucleosomes. Our study suggests that the topological entrapment of the linker DNA by CCAN provides a robust mechanism by which kinetochores withstand both pushing and pulling forces exerted by the mitotic spindle.
History
DepositionJul 31, 2021Deposition site: PDBE / Processing site: PDBE
Revision 1.0Apr 27, 2022Provider: repository / Type: Initial release
Revision 1.1Jun 1, 2022Group: Database references / Category: citation / citation_author
Item: _citation.journal_volume / _citation.page_first ..._citation.journal_volume / _citation.page_first / _citation.page_last / _citation_author.identifier_ORCID
Revision 1.2Jan 31, 2024Group: Data collection / Refinement description
Category: chem_comp_atom / chem_comp_bond / pdbx_initial_refinement_model

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
O: Centromere protein O
Q: Centromere protein Q
U: Centromere protein U
P: Centromere protein P
R: Centromere protein R


Theoretical massNumber of molelcules
Total (without water)151,1175
Polymers151,1175
Non-polymers00
Water181
1


  • Idetical with deposited unit
  • defined by author&software
  • Evidence: gel filtration
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Buried area17500 Å2
ΔGint-152 kcal/mol
Surface area39460 Å2
MethodPISA
Unit cell
Length a, b, c (Å)199.614, 51.299, 109.999
Angle α, β, γ (deg.)90.000, 117.490, 90.000
Int Tables number5
Space group name H-MC121
Space group name HallC2y

-
Components

-
Centromere protein ... , 5 types, 5 molecules OQUPR

#1: Protein Centromere protein O / CENP-O / Interphase centromere complex protein 36


Mass: 33830.637 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Gene: CENPO, ICEN36, MCM21R / Production host: Trichoplusia ni (cabbage looper) / Variant (production host): HighFive / References: UniProt: Q9BU64
#2: Protein Centromere protein Q / CENP-Q


Mass: 15442.636 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Gene: CENPQ, C6orf139 / Production host: Trichoplusia ni (cabbage looper) / Variant (production host): HighFive / References: UniProt: Q7L2Z9
#3: Protein Centromere protein U / CENP-U / Centromere protein of 50 kDa / CENP-50 / Interphase centromere complex protein 24 / KSHV ...CENP-U / Centromere protein of 50 kDa / CENP-50 / Interphase centromere complex protein 24 / KSHV latent nuclear antigen-interacting protein 1 / MLF1-interacting protein / Polo-box-interacting protein 1


Mass: 47609.766 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Details: MAPRGRRRPRPHRSEGARRSKNTLERTHSMKDKAGQKCKPIDVFDFPDNSDVSSIGRLGE NEKDEETYETFDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIES VKISAKKPGRKLRPISDDSESIEESDTRRKVKSAEKISTQRHEVIRTTASSELSEKPAES ...Details: MAPRGRRRPRPHRSEGARRSKNTLERTHSMKDKAGQKCKPIDVFDFPDNSDVSSIGRLGE NEKDEETYETFDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIES VKISAKKPGRKLRPISDDSESIEESDTRRKVKSAEKISTQRHEVIRTTASSELSEKPAES VTSKKTGPLSAQPSVEKENLAIESQSKTQKKGKISHDKRKKSRSKAIGSDTSDIVHIWCP EGMKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIATFYVNVKEQFIKMLKESQMLT NLKRKNAKMISDIEKKRQRMIEVQDELLRLEPQLKQLQTKYDELKERKSSLRNAAYFLSN LKQLYQDYSDVQAQEPNVKETYDSSSLPALLFKARTLLGAESHLRNINHQLEKLLDQG
Source: (gene. exp.) Homo sapiens (human) / Gene: CENPU, ICEN24, KLIP1, MLF1IP, PBIP1 / Production host: Trichoplusia ni (cabbage looper) / Variant (production host): HighFive / References: UniProt: Q71F23
#4: Protein Centromere protein P / CENP-P


Mass: 34005.797 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Gene: CENPP / Production host: Trichoplusia ni (cabbage looper) / Variant (production host): HighFive / References: UniProt: Q6IPU0
#5: Protein Centromere protein R / CENP-R / Beta-3-endonexin / Integrin beta-3-binding protein / Nuclear receptor-interacting factor 3


Mass: 20228.297 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Gene: ITGB3BP, CENPR, NRIF3 / Production host: Trichoplusia ni (cabbage looper) / Variant (production host): HighFive / References: UniProt: Q13352

-
Non-polymers , 1 types, 1 molecules

#6: Water ChemComp-HOH / water


Mass: 18.015 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Formula: H2O

-
Experimental details

-
Experiment

ExperimentMethod: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

CrystalDensity Matthews: 2.1 Å3/Da / Density % sol: 41.39 %
Crystal growTemperature: 291 K / Method: vapor diffusion, sitting drop
Details: 15% PEG2kmme, 40 mM NaFormate, 200 mM bis-tris propane pH 6.9

-
Data collection

DiffractionMean temperature: 100 K / Serial crystal experiment: N
Diffraction sourceSource: SYNCHROTRON / Site: Diamond / Beamline: I24 / Wavelength: 0.9795 Å
DetectorType: DECTRIS PILATUS 6M / Detector: PIXEL / Date: Jun 20, 2021
RadiationProtocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelengthWavelength: 0.9795 Å / Relative weight: 1
ReflectionResolution: 3.68→46.3 Å / Num. obs: 6104 / % possible obs: 77.5 % / Redundancy: 2.5 % / Biso Wilson estimate: 79.89 Å2 / CC1/2: 0.98 / Rmerge(I) obs: 0.084 / Net I/σ(I): 7.6
Reflection shellResolution: 3.68→3.9 Å / Rmerge(I) obs: 0.35 / Num. unique obs: 6104

-
Processing

Software
NameVersionClassification
REFMAC1.17.1_3660refinement
PHENIX1.17.1_3660refinement
PDB_EXTRACT3.27data extraction
MOSFLMdata reduction
STARANISOdata scaling
PHASERphasing
RefinementMethod to determine structure: MOLECULAR REPLACEMENT
Starting model: 6QLF
Resolution: 3.68→25.65 Å / SU ML: 0.6215 / Cross valid method: FREE R-VALUE / σ(F): 1.33 / Phase error: 25.7058
Stereochemistry target values: GeoStd + Monomer Library + CDL v1.2
RfactorNum. reflection% reflection
Rfree0.3521 295 4.83 %
Rwork0.2563 5809 -
obs0.2608 6104 55.44 %
Solvent computationShrinkage radii: 0.9 Å / VDW probe radii: 1.11 Å / Solvent model: FLAT BULK SOLVENT MODEL
Displacement parametersBiso mean: 100.91 Å2
Refinement stepCycle: LAST / Resolution: 3.68→25.65 Å
ProteinNucleic acidLigandSolventTotal
Num. atoms5705 0 0 1 5706
Refine LS restraints
Refine-IDTypeDev idealNumber
X-RAY DIFFRACTIONf_bond_d0.00435792
X-RAY DIFFRACTIONf_angle_d0.75387791
X-RAY DIFFRACTIONf_chiral_restr0.0463897
X-RAY DIFFRACTIONf_plane_restr0.0042992
X-RAY DIFFRACTIONf_dihedral_angle_d6.37749
LS refinement shell
Resolution (Å)Rfactor RfreeNum. reflection RfreeRfactor RworkNum. reflection RworkRefine-ID% reflection obs (%)
3.68-4.630.4279650.281289X-RAY DIFFRACTION24.94
4.63-25.650.33452300.25094520X-RAY DIFFRACTION85.11
Refinement TLS params.

Method: refined / Refine-ID: X-RAY DIFFRACTION

IDL112)L122)L132)L222)L232)L332)S11 (Å °)S12 (Å °)S13 (Å °)S21 (Å °)S22 (Å °)S23 (Å °)S31 (Å °)S32 (Å °)S33 (Å °)T112)T122)T132)T222)T232)T332)Origin x (Å)Origin y (Å)Origin z (Å)
14.64065533549-1.87388386843-2.11332787624.29259108463.155833251464.160213251440.337988359389-0.2428106005910.582109373588-0.6656129810560.880059646075-1.02987918260.06609979880081.91022168232-0.2676392655581.176020730830.03343325945230.3173741033221.94766280050.124075431890.44824404748657.40982446591.0232317938130.432612508
23.28927035703-1.165789133020.2207606613742.3438761449-0.6911539356291.86101628525-0.03062644055340.155607619164-0.566856418684-0.438143145422-0.3165656460450.1414313513230.964663975551-0.259468483489-0.006570951538870.800724742667-0.3323199231510.03198060024390.508461728281-0.3300344220960.28814429990636.3766877826-8.9013482726436.5769786261
32.53530871348-0.883292349437-0.5048059368492.17500132656-0.02730166398792.26804326663-0.5820207061080.312593282344-0.5747725027410.135132835209-0.1680996451240.5108750141460.585547611207-0.3102368430150.5337766259340.40842073139-0.02311070688740.3060320621080.52790761738-0.03378671074470.43941314088324.4128140137-1.3262423348736.3069352509
41.655577093610.5092211703981.623409378282.15043390283-1.119579575962.90531430431-0.283741636756-1.19694436997-0.1672664233110.345244126410.01383208117620.585254935288-0.229236436998-0.351412601903-0.2560419740490.298052411137-0.1799874090850.1302647754770.864330826643-0.1738701344550.78616371729511.01760123318.7748923450344.2376866955
53.7789153764-0.160912768155-1.185948566030.981814570341-0.7494194196360.99062811270.496602491805-0.377784555059-0.6064326852170.108992267607-0.4707520283430.829810318972-0.0380866931451-0.3757926931690.1938783330180.976597824288-0.5807212939510.004186161805340.728974920985-0.158994489260.50854004503411.36258219815.6138944892736.0464339775
62.616023382832.296777354761.867495346612.476872006372.780666698834.16187214756-0.40321570246-0.1530193749291.28452548734-1.011717058690.2529223568180.89526112776-0.930241891080.0232118153594-0.07876706196191.28245312248-0.269910167511-0.3390809024231.612120955621.107300367752.19952556768-1.6758638816513.278690538439.102432625
70.000682811534814-0.0663562257822-0.01915296005362.312373489030.6578332577530.1853871894170.274751763863-0.1822417804220.546601289344-0.209905810042-0.1706706233980.60154587364-0.50165885264-1.761068312640.1014505961860.371639538060.208177247973-0.3848744001961.383471795770.1701975063841.632888773264.1384266251216.54523930634.0378500758
81.22475531031.194782255093.477865125593.24249374263.433881331819.85806755546-1.22078159627-0.3090638883670.3855822566970.157877648163-0.5302868757220.981328922738-0.476810610151-0.7477115082470.2223248919540.467083532360.1282631970.2847517103870.407338981230.1604120328931.2077659823116.933119511918.226944874636.6421149135
91.80997000115-0.4796993470160.9543338503171.29448993572-0.8285192765952.030953731170.671763737506-1.18374912504-0.284290702045-0.186558019450.776752065003-0.132513434974-0.252267330631-0.9084849236-0.8037448423590.920679905313-0.248154079786-0.222696169091.005717381430.3269337265991.18307633687-5.61613258614-17.760486622729.7649668369
102.440466334931.282900090950.9205535759780.729340584402-0.01078271195583.752655978490.06893080713250.4740391311540.415630587331-0.166497330134-1.094750977130.0521646894789-0.2969174761730.1315442145311.108362972170.7144118312010.310301867469-0.007558594299970.561812420692-0.0732412089550.80678630093518.6037458972-16.40388575667.55749676566
113.644869939470.459980533259-0.8313157384660.0739418550989-0.3852454503772.989964954460.1565756694390.7528310779050.540351618740.3916371354540.686410207639-0.8907674536140.02481473210530.390489668424-0.6005190373321.33414129354-0.452143378601-0.2602173220950.6529156216290.07496421069411.2889947614622.86793361687.53151157133-4.72689891133
122.621139584610.1640196092-0.294462139061.79642469838-0.5805226658071.584490408930.538422989723-0.131518524232-0.2913905693730.0994549884691-0.1039295809950.160136423740.01871118364840.488732185409-0.3165730104980.335595626551-0.219951462872-0.1847603589270.968037818175-0.1823154162920.6716232773866.83743126209-7.487067528999.64565515846
133.81836766195-2.671798212491.750106889627.98884141101-0.5356050146894.49548804148-0.513818785304-0.541951813534-0.085665115878-0.2065961157871.586580883650.1437926642910.0106596286572-0.341659172807-1.275319908812.044978744360.2492773947380.3704075548421.560755742170.07725535041841.4050465698244.00133495979.12566183830.414531139713
141.902502307950.127422039616-0.01072572380972.694190840181.236068173541.31036911891-0.2078676411690.2439095781340.455911996334-0.497346370460.277958608728-0.211358114378-0.5833529360421.009930163130.04565394249051.07447203742-0.3934911918430.2616904102730.970887098573-0.1518956149650.641605710141.04186588315.9567056607425.9620911394
154.45662429909-1.42681035003-1.48124947240.6667404842590.0149094501141.469345222830.2379134443110.4507541337230.706900061039-0.2845878834820.60405114008-0.14577345809-0.3406050176740.796268145327-0.4873163438480.53561621871-0.1276965674240.03643100860591.11259856157-0.2095081726330.67131794004829.40365758-7.37704646858-2.97078696915
161.20065523854-0.462870152023-0.2026110047920.6667186743280.2277720284122.173967824150.6844464164470.702067581323-0.322839232634-0.3078937292440.0344232042485-0.130951499686-0.4015467167960.382402980162-0.3063700519711.10782253208-0.482576628386-0.3091548091180.902670525607-0.2615805340520.27399552754421.6799755567-0.1146416989463.28493805567
170.8225758829960.602106083203-0.8530791466523.431520960511.086272779212.29384056568-0.1582959001090.329905450120.378100718995-1.5221585167-0.5508134202240.221465596608-0.92584725266-0.6226874735110.3919284950671.140828722580.362015880117-0.442348335790.406627742584-0.131915918230.9329547827138.20519879354-0.784719379652-8.53159651528
180.670003547980.119881134588-0.8452848356420.0465711405016-0.1821524065021.104152083180.14291407140.648946461590.111170727889-0.2258319603160.1438899879960.1638429147560.402530543811-0.3322013531150.4777585853460.5766211434790.469612102583-0.7358332704990.657352463833-0.1373041119910.59841543550414.3418814821-9.309936726912.08962385759
192.62287524981-1.051421790091.055711881182.828760189552.205607709583.27005031022-0.4021994572891.539740663231.08913645408-0.3615103530151.32632773784-0.173539433552-1.148178011450.5648546080620.08623677590391.88493701593-0.6132907687280.5794351080621.503749286150.4092360711981.6688479469233.748837468216.6210676103-13.9889632788
202.587588170980.01919057213771.302890383313.06474453431.222466323431.135906113440.6488447185780.644856420537-0.0115520676327-0.198851112127-0.0574579403971-0.0841051322327-0.7688116159760.1160730369660.1530893688142.33192694372-0.02342247386990.1330531669512.56833930643-0.1785494746430.50319583823925.022603858517.78258018941.95693964442
215.759820046490.3046672020730.03008262989180.4940121026010.4189518475960.365577038217-0.08902700765690.4610243084560.858829578478-0.117215195273-0.273003021465-0.2221172783860.228489447967-0.0537658939768-0.2456031565051.30577060113-0.02638762449051.274667837152.302967830110.03771546916862.3359633999446.083246069513.0851309654-7.24230162383
Refinement TLS group
IDRefine-IDRefine TLS-IDSelection detailsAuth asym-IDAuth seq-ID
1X-RAY DIFFRACTION1{ A|89-111 }O89 - 111
2X-RAY DIFFRACTION2{ A|112-160 }O112 - 160
3X-RAY DIFFRACTION3{ A|161-210 }O161 - 210
4X-RAY DIFFRACTION4{ A|211-230 }O211 - 230
5X-RAY DIFFRACTION5{ O|231-248 }O231 - 248
6X-RAY DIFFRACTION6{ O|249-261 }O249 - 261
7X-RAY DIFFRACTION7{ O|262-276 }O262 - 276
8X-RAY DIFFRACTION8{ O|277-289 }O277 - 289
9X-RAY DIFFRACTION9{ Q|153-198 }Q153 - 198
10X-RAY DIFFRACTION10{ Q|199-215 }Q199 - 215
11X-RAY DIFFRACTION11{ Q|216-268 }Q216 - 268
12X-RAY DIFFRACTION12{ U|315-398 }U315 - 398
13X-RAY DIFFRACTION13{ U|399-417 }U399 - 417
14X-RAY DIFFRACTION14{ P|53-184 }P54 - 184
15X-RAY DIFFRACTION15{ P|185-205 }P185 - 205
16X-RAY DIFFRACTION16{ P|206-235 }P206 - 235
17X-RAY DIFFRACTION17{ P|236-255 }P236 - 255
18X-RAY DIFFRACTION18{ P|256-283 }P256 - 283
19X-RAY DIFFRACTION19{ R|84-113 }R84 - 113
20X-RAY DIFFRACTION20{ R|114-130 }R114 - 130
21X-RAY DIFFRACTION21{ R|131-152 }R131 - 152

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more