[English] 日本語
Yorodumi- PDB-6yye: TREM2 extracellular domain (19-131) in complex with single-chain ... -
+
Open data
-
Basic information
| Entry | Database: PDB / ID: 6yye | ||||||
|---|---|---|---|---|---|---|---|
| Title | TREM2 extracellular domain (19-131) in complex with single-chain variable fragment (scFv-2) | ||||||
Components |
| ||||||
Keywords | IMMUNE SYSTEM / scFv / complex / receptor / Alzheimer's | ||||||
| Function / homology | Function and homology informationpositive regulation of high-density lipoprotein particle clearance / regulation of toll-like receptor 6 signaling pathway / positive regulation of complement activation, classical pathway / detection of lipoteichoic acid / regulation of macrophage inflammatory protein 1 alpha production / regulation of hippocampal neuron apoptotic process / regulation of plasma membrane bounded cell projection organization / positive regulation of C-C chemokine receptor CCR7 signaling pathway / excitatory synapse pruning / positive regulation of CD40 signaling pathway ...positive regulation of high-density lipoprotein particle clearance / regulation of toll-like receptor 6 signaling pathway / positive regulation of complement activation, classical pathway / detection of lipoteichoic acid / regulation of macrophage inflammatory protein 1 alpha production / regulation of hippocampal neuron apoptotic process / regulation of plasma membrane bounded cell projection organization / positive regulation of C-C chemokine receptor CCR7 signaling pathway / excitatory synapse pruning / positive regulation of CD40 signaling pathway / negative regulation of triglyceride storage / negative regulation of cell activation / detection of peptidoglycan / import into cell / sulfatide binding / positive regulation of establishment of protein localization / positive regulation of macrophage fusion / negative regulation of fat cell proliferation / lipoteichoic acid binding / positive regulation of engulfment of apoptotic cell / positive regulation of synapse pruning / negative regulation of macrophage colony-stimulating factor signaling pathway / microglial cell activation involved in immune response / negative regulation of toll-like receptor 2 signaling pathway / positive regulation of antigen processing and presentation of peptide antigen via MHC class II / respiratory burst after phagocytosis / negative regulation of astrocyte activation / positive regulation of CAMKK-AMPK signaling cascade / semaphorin receptor binding / positive regulation of low-density lipoprotein particle clearance / negative regulation of autophagic cell death / positive regulation of microglial cell migration / detection of lipopolysaccharide / Other semaphorin interactions / T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell / apolipoprotein A-I binding / negative regulation of toll-like receptor 4 signaling pathway / CXCL12-activated CXCR4 signaling pathway / negative regulation of neuroinflammatory response / negative regulation of p38MAPK cascade / very-low-density lipoprotein particle binding / cellular response to oxidised low-density lipoprotein particle stimulus / phagocytosis, recognition / high-density lipoprotein particle binding / negative regulation of glial cell apoptotic process / dendritic cell differentiation / microglial cell proliferation / positive regulation of microglial cell activation / complement-mediated synapse pruning / amyloid-beta clearance by cellular catabolic process / low-density lipoprotein particle binding / cellular response to lipoprotein particle stimulus / semaphorin receptor complex / negative regulation of NLRP3 inflammasome complex assembly / cellular response to peptidoglycan / regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway / peptidoglycan binding / regulation of resting membrane potential / positive regulation of amyloid-beta clearance / regulation of TOR signaling / positive regulation of phagocytosis, engulfment / positive regulation of potassium ion transport / semaphorin receptor activity / positive regulation of chemotaxis / phosphatidylethanolamine binding / positive regulation of osteoclast differentiation / negative regulation of amyloid fibril formation / regulation of interleukin-6 production / positive regulation of proteasomal protein catabolic process / cellular response to lipid / kinase activator activity / apoptotic cell clearance / dendritic spine maintenance / phagocytosis, engulfment / negative regulation of interleukin-1 beta production / regulation of innate immune response / phosphatidylserine binding / regulation of cytokine production involved in inflammatory response / negative regulation of cholesterol storage / cellular response to lipoteichoic acid / lipid homeostasis / lipoprotein particle binding / humoral immune response / amyloid-beta clearance / positive regulation of ATP biosynthetic process / regulation of lipid metabolic process / positive regulation of intracellular signal transduction / positive regulation of interleukin-10 production / apolipoprotein binding / negative regulation of tumor necrosis factor production / positive regulation of cholesterol efflux / pyroptotic inflammatory response / plasma membrane raft / positive regulation of TOR signaling / social behavior / response to axon injury / negative regulation of cytokine production involved in inflammatory response / positive regulation of calcium-mediated signaling / osteoclast differentiation / positive regulation of phagocytosis Similarity search - Function | ||||||
| Biological species | Homo sapiens (human) | ||||||
| Method | X-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 3.36 Å | ||||||
Authors | Szykowska, A. / Preger, C. / Krojer, T. / Mukhopadhyay, S.M.M. / McKinley, G. / Graslund, S. / Wigren, E. / Persson, H. / von Delft, F. / Arrowsmith, C.H. ...Szykowska, A. / Preger, C. / Krojer, T. / Mukhopadhyay, S.M.M. / McKinley, G. / Graslund, S. / Wigren, E. / Persson, H. / von Delft, F. / Arrowsmith, C.H. / Edwards, A. / Bountra, C. / Di Daniel, E. / Burgess-Brown, N. / Bullock, A. | ||||||
Citation | Journal: Structure / Year: 2021Title: Selection and structural characterization of anti-TREM2 scFvs that reduce levels of shed ectodomain. Authors: Szykowska, A. / Chen, Y. / Smith, T.B. / Preger, C. / Yang, J. / Qian, D. / Mukhopadhyay, S.M. / Wigren, E. / Neame, S.J. / Graslund, S. / Persson, H. / Atkinson, P.J. / Di Daniel, E. / ...Authors: Szykowska, A. / Chen, Y. / Smith, T.B. / Preger, C. / Yang, J. / Qian, D. / Mukhopadhyay, S.M. / Wigren, E. / Neame, S.J. / Graslund, S. / Persson, H. / Atkinson, P.J. / Di Daniel, E. / Mead, E. / Wang, J. / Davis, J.B. / Burgess-Brown, N.A. / Bullock, A.N. #1: Journal: Biorxiv / Year: 2021Title: Selection and structural characterisation of anti-TREM2 scFvs that reduce levels of shed ectodomain Authors: Szykowska, A. / Chen, Y. / Smith, T.B. / Preger, C. / Yang, J. / Qian, D. / Mukhopadhyay, S. / Wigren, E. / Neame, S.J. / Graslund, S. / Persson, H. / Atkinson, P.J. / Di Daniel, E. / Mead, ...Authors: Szykowska, A. / Chen, Y. / Smith, T.B. / Preger, C. / Yang, J. / Qian, D. / Mukhopadhyay, S. / Wigren, E. / Neame, S.J. / Graslund, S. / Persson, H. / Atkinson, P.J. / Di Daniel, E. / Mead, E. / Wang, J. / Davis, J.B. / Burgess-Brown, N.A. / Bullock, A.N. | ||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 6yye.cif.gz | 317.7 KB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb6yye.ent.gz | 220.5 KB | Display | PDB format |
| PDBx/mmJSON format | 6yye.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/yy/6yye ftp://data.pdbj.org/pub/pdb/validation_reports/yy/6yye | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 6y6cC ![]() 6ymqC ![]() 6cy6S S: Starting model for refinement C: citing same article ( |
|---|---|
| Similar structure data |
-
Links
-
Assembly
| Deposited unit | ![]()
| ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | ![]()
| ||||||||||
| 2 | ![]()
| ||||||||||
| Unit cell |
|
-
Components
| #1: Protein | Mass: 12951.615 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Details: MHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLAD Source: (gene. exp.) Homo sapiens (human) / Gene: TREM2 / Production host: Homo sapiens (human) / References: UniProt: Q9NZC2#2: Antibody | Mass: 26200.885 Da / Num. of mol.: 2 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Homo sapiens (human) / Production host: ![]() #3: Sugar | ChemComp-NAG / | Has ligand of interest | N | Has protein modification | Y | |
|---|
-Experimental details
-Experiment
| Experiment | Method: X-RAY DIFFRACTION / Number of used crystals: 1 |
|---|
-
Sample preparation
| Crystal | Density Matthews: 5.39 Å3/Da / Density % sol: 77.18 % / Description: Large cubes |
|---|---|
| Crystal grow | Temperature: 293.15 K / Method: vapor diffusion, sitting drop / pH: 8.5 Details: 0.015M nickel chloride,0.1M tris pH 8.5,2.2M ammonium acetate |
-Data collection
| Diffraction | Mean temperature: 100 K / Serial crystal experiment: N |
|---|---|
| Diffraction source | Source: SYNCHROTRON / Site: Diamond / Beamline: I24 / Wavelength: 0.9763 Å |
| Detector | Type: RAYONIX MX-300 / Detector: CCD / Date: Apr 17, 2019 |
| Radiation | Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray |
| Radiation wavelength | Wavelength: 0.9763 Å / Relative weight: 1 |
| Reflection | Resolution: 3.356→110.07 Å / Num. obs: 16278 / % possible obs: 92 % / Redundancy: 13.4 % / Biso Wilson estimate: 79.88 Å2 / CC1/2: 0.998 / Net I/σ(I): 7.4 |
| Reflection shell | Resolution: 3.356→3.679 Å / Num. unique obs: 814 / CC1/2: 0.749 |
-
Processing
| Software |
| |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Refinement | Method to determine structure: MOLECULAR REPLACEMENTStarting model: 6CY6 Resolution: 3.36→110.07 Å / SU ML: 0.5925 / Cross valid method: FREE R-VALUE / σ(F): 1.34 / Phase error: 36.8277 Stereochemistry target values: GeoStd + Monomer Library + CDL v1.2
| |||||||||||||||||||||||||||||||||||||||||||||||||
| Solvent computation | Shrinkage radii: 0.9 Å / VDW probe radii: 1.11 Å / Solvent model: FLAT BULK SOLVENT MODEL | |||||||||||||||||||||||||||||||||||||||||||||||||
| Displacement parameters | Biso mean: 91.39 Å2 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement step | Cycle: LAST / Resolution: 3.36→110.07 Å
| |||||||||||||||||||||||||||||||||||||||||||||||||
| Refine LS restraints |
| |||||||||||||||||||||||||||||||||||||||||||||||||
| LS refinement shell |
| |||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement TLS params. | Method: refined / Origin x: -26.1951235583 Å / Origin y: -30.813459225 Å / Origin z: -57.1322426139 Å
| |||||||||||||||||||||||||||||||||||||||||||||||||
| Refinement TLS group | Selection details: all |
Movie
Controller
About Yorodumi



Homo sapiens (human)
X-RAY DIFFRACTION
Citation












PDBj







