[English] 日本語
Yorodumi
- PDB-2erf: Crystal Structure of the Thrombospondin-1 N-terminal Domain at 1.... -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 2erf
TitleCrystal Structure of the Thrombospondin-1 N-terminal Domain at 1.45A Resolution
ComponentsThrombospondin-1
KeywordsSUGAR BINDING PROTEIN / Thrombospondin-1 / TSP-1 / N-terminal TSPN / HBD
Function / homology
Function and homology information


negative regulation of antigen processing and presentation of peptide or polysaccharide antigen via MHC class II / collagen V binding / thrombospondin complex / endothelial cell-cell adhesion / negative regulation of dendritic cell antigen processing and presentation / positive regulation of extrinsic apoptotic signaling pathway via death domain receptors / negative regulation of sprouting angiogenesis / chronic inflammatory response / negative regulation of endothelial cell chemotaxis / Defective B3GALTL causes PpS ...negative regulation of antigen processing and presentation of peptide or polysaccharide antigen via MHC class II / collagen V binding / thrombospondin complex / endothelial cell-cell adhesion / negative regulation of dendritic cell antigen processing and presentation / positive regulation of extrinsic apoptotic signaling pathway via death domain receptors / negative regulation of sprouting angiogenesis / chronic inflammatory response / negative regulation of endothelial cell chemotaxis / Defective B3GALTL causes PpS / negative regulation of fibroblast growth factor receptor signaling pathway / O-glycosylation of TSR domain-containing proteins / negative regulation of nitric oxide-cGMP mediated signal transduction / negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis / negative regulation of long-chain fatty acid import across plasma membrane / positive regulation of transforming growth factor beta1 production / fibrinogen complex / negative regulation of interleukin-12 production / blood coagulation, fibrin clot formation / engulfment of apoptotic cell / low-density lipoprotein particle binding / negative regulation of focal adhesion assembly / Signaling by PDGF / negative regulation of plasminogen activation / platelet alpha granule / negative regulation of cell migration involved in sprouting angiogenesis / fibrinogen binding / positive regulation of chemotaxis / positive regulation of macrophage activation / transforming growth factor beta binding / sprouting angiogenesis / positive regulation of fibroblast migration / proteoglycan binding / negative regulation of cell-matrix adhesion / negative regulation of endothelial cell migration / negative regulation of receptor guanylyl cyclase signaling pathway / negative regulation of interleukin-10 production / Syndecan interactions / extracellular matrix structural constituent / phosphatidylserine binding / negative regulation of endothelial cell proliferation / positive regulation of transforming growth factor beta receptor signaling pathway / positive regulation of macrophage chemotaxis / endopeptidase inhibitor activity / behavioral response to pain / fibronectin binding / response to progesterone / response to testosterone / negative regulation of blood vessel endothelial cell migration / negative regulation of fibrinolysis / fibroblast growth factor binding / positive regulation of phosphorylation / response to glucose / negative regulation of tumor necrosis factor production / positive regulation of endothelial cell apoptotic process / positive regulation of blood vessel endothelial cell migration / Integrin cell surface interactions / response to magnesium ion / response to mechanical stimulus / nitric oxide-cGMP-mediated signaling / negative regulation of angiogenesis / laminin binding / positive regulation of endothelial cell migration / positive regulation of smooth muscle cell proliferation / secretory granule / response to endoplasmic reticulum stress / platelet alpha granule lumen / negative regulation of extrinsic apoptotic signaling pathway / cellular response to tumor necrosis factor / sarcoplasmic reticulum / positive regulation of translation / response to calcium ion / RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function / cellular response to growth factor stimulus / integrin binding / positive regulation of reactive oxygen species metabolic process / positive regulation of angiogenesis / positive regulation of tumor necrosis factor production / heparin binding / Platelet degranulation / cell migration / cellular response to heat / protease binding / extracellular matrix / response to hypoxia / positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction / cell adhesion / positive regulation of MAPK cascade / inflammatory response / response to xenobiotic stimulus / positive regulation of cell migration / immune response / negative regulation of cell population proliferation / endoplasmic reticulum lumen / external side of plasma membrane / calcium ion binding / positive regulation of cell population proliferation / negative regulation of apoptotic process / cell surface / endoplasmic reticulum
Similarity search - Function
Thrombospondin, C-terminal / Thrombospondin, type 3 repeat / Thrombospondin C-terminal region / Thrombospondin type-3 (TSP3) repeat profile. / Thrombospondin C-terminal domain profile. / Thrombospondin, type 3-like repeat / Thrombospondin type 3 repeat / TSP type-3 repeat / : / Thrombospondin N-terminal -like domains. ...Thrombospondin, C-terminal / Thrombospondin, type 3 repeat / Thrombospondin C-terminal region / Thrombospondin type-3 (TSP3) repeat profile. / Thrombospondin C-terminal domain profile. / Thrombospondin, type 3-like repeat / Thrombospondin type 3 repeat / TSP type-3 repeat / : / Thrombospondin N-terminal -like domains. / von Willebrand factor type C domain / VWFC domain signature. / VWFC domain profile. / von Willebrand factor (vWF) type C domain / VWFC domain / Thrombospondin type 1 domain / Thrombospondin type-1 (TSP1) repeat superfamily / Thrombospondin type-1 (TSP1) repeat profile. / Thrombospondin type 1 repeats / Thrombospondin type-1 (TSP1) repeat / EGF-like calcium-binding domain / Calcium-binding EGF-like domain / Jelly Rolls - #200 / Epidermal growth factor-like domain. / EGF-like domain profile. / EGF-like domain signature 2. / EGF-like domain / Concanavalin A-like lectin/glucanase domain superfamily / Jelly Rolls / Sandwich / Mainly Beta
Similarity search - Domain/homology
Biological speciesHomo sapiens (human)
MethodX-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 1.45 Å
AuthorsTan, K. / Wang, J. / Lawler, J.
CitationJournal: Structure / Year: 2006
Title: The structures of the thrombospondin-1 N-terminal domain and its complex with a synthetic pentameric heparin.
Authors: Tan, K. / Duquette, M. / Liu, J.H. / Zhang, R. / Joachimiak, A. / Wang, J.H. / Lawler, J.
History
DepositionOct 24, 2005Deposition site: RCSB / Processing site: RCSB
Revision 1.0Jan 17, 2006Provider: repository / Type: Initial release
Revision 1.1May 1, 2008Group: Version format compliance
Revision 1.2Jul 13, 2011Group: Version format compliance
Revision 1.3Aug 23, 2023Group: Data collection / Database references / Refinement description
Category: chem_comp_atom / chem_comp_bond ...chem_comp_atom / chem_comp_bond / database_2 / pdbx_initial_refinement_model
Item: _database_2.pdbx_DOI / _database_2.pdbx_database_accession
Revision 1.4Nov 6, 2024Group: Structure summary / Category: pdbx_entry_details / pdbx_modification_feature
Remark 999SEQUENCE THE SEQUENCE OF THE WHOLE CONSTRUCT IS LISTED HERE: ...SEQUENCE THE SEQUENCE OF THE WHOLE CONSTRUCT IS LISTED HERE: RSPWNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDA NLIPPVPDDKFQDLVDAVRTEKGFLLLASLRQMKKTRGTLLALERKDHSG QVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDR AQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQN VRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGSSPAIRTNTGHHHHHH THE PURIFIED PROTEIN WAS TREATED WITH CHYMOTRYPSIN AND RE-PURIFIED BEFORE CRYSTALLIZATION. THE EXACT N-TERMINAL OR C-TERMINAL SEQUENCES ARE NOT KNOWN. THE SEQRES REPRESENTS THE RESIDUES IN THE COORDINATES.

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
A: Thrombospondin-1


Theoretical massNumber of molelcules
Total (without water)22,9011
Polymers22,9011
Non-polymers00
Water3,909217
1


  • Idetical with deposited unit
  • defined by author
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Unit cell
Length a, b, c (Å)43.310, 40.489, 60.086
Angle α, β, γ (deg.)90.00, 106.99, 90.00
Int Tables number4
Space group name H-MP1211

-
Components

#1: Protein Thrombospondin-1


Mass: 22901.035 Da / Num. of mol.: 1 / Fragment: N-terminal Domain
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Gene: THBS1, TSP, TSP1 / Cell line (production host): S2 Cell / Production host: Drosophila melanogaster (fruit fly) / References: UniProt: P07996
#2: Water ChemComp-HOH / water


Mass: 18.015 Da / Num. of mol.: 217 / Source method: isolated from a natural source / Formula: H2O
Has protein modificationY

-
Experimental details

-
Experiment

ExperimentMethod: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

CrystalDensity Matthews: 2.2 Å3/Da / Density % sol: 42.7 %
Crystal growTemperature: 300 K / Method: vapor diffusion, hanging drop / pH: 4.6
Details: 30% PEG1500 and 0.1M Sodium Acetate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 300K

-
Data collection

DiffractionMean temperature: 100 K
Diffraction sourceSource: SYNCHROTRON / Site: APS / Beamline: 19-ID / Wavelength: 1.00931 Å
DetectorType: ADSC QUANTUM 315 / Detector: CCD / Date: Jul 7, 2005
RadiationMonochromator: Graphite / Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelengthWavelength: 1.00931 Å / Relative weight: 1
ReflectionResolution: 1.45→30 Å / Num. all: 34155 / Num. obs: 34155 / % possible obs: 95.8 % / Observed criterion σ(F): 0 / Observed criterion σ(I): 0 / Redundancy: 3.8 % / Biso Wilson estimate: 29.2 Å2 / Rmerge(I) obs: 0.068 / Net I/σ(I): 39.7
Reflection shellResolution: 1.45→1.5 Å / Redundancy: 2.3 % / Rmerge(I) obs: 0.376 / Mean I/σ(I) obs: 2.5 / Num. unique all: 2422 / % possible all: 68.7

-
Processing

Software
NameVersionClassification
REFMAC5.2.0005refinement
HKL-2000data reduction
SCALEPACKdata scaling
AMoREphasing
RefinementMethod to determine structure: MOLECULAR REPLACEMENT
Starting model: PDB ENTRY 1Z78
Resolution: 1.45→22.86 Å / Cor.coef. Fo:Fc: 0.966 / Cor.coef. Fo:Fc free: 0.952 / SU B: 2.702 / SU ML: 0.048 / Cross valid method: THROUGHOUT / σ(F): 0 / ESU R: 0.099 / ESU R Free: 0.08 / Stereochemistry target values: MAXIMUM LIKELIHOOD
RfactorNum. reflection% reflectionSelection details
Rfree0.21672 2575 7.7 %RANDOM
Rwork0.18301 ---
all0.1863 30931 --
obs0.18559 30931 94.38 %-
Solvent computationIon probe radii: 0.8 Å / Shrinkage radii: 0.8 Å / VDW probe radii: 1.2 Å / Solvent model: MASK
Displacement parametersBiso mean: 25.962 Å2
Baniso -1Baniso -2Baniso -3
1--0.01 Å20 Å20 Å2
2--0.01 Å20 Å2
3---0 Å2
Refinement stepCycle: LAST / Resolution: 1.45→22.86 Å
ProteinNucleic acidLigandSolventTotal
Num. atoms1609 0 0 217 1826
Refine LS restraints
Refine-IDTypeDev idealDev ideal targetNumber
X-RAY DIFFRACTIONr_bond_refined_d0.0110.0221634
X-RAY DIFFRACTIONr_angle_refined_deg1.4671.9742206
X-RAY DIFFRACTIONr_dihedral_angle_1_deg6.1655208
X-RAY DIFFRACTIONr_dihedral_angle_2_deg32.76224.26775
X-RAY DIFFRACTIONr_dihedral_angle_3_deg13.20815293
X-RAY DIFFRACTIONr_dihedral_angle_4_deg19.1381514
X-RAY DIFFRACTIONr_chiral_restr0.0960.2253
X-RAY DIFFRACTIONr_gen_planes_refined0.0060.021229
X-RAY DIFFRACTIONr_nbd_refined0.2150.2710
X-RAY DIFFRACTIONr_nbtor_refined0.3090.21135
X-RAY DIFFRACTIONr_xyhbond_nbd_refined0.1580.2187
X-RAY DIFFRACTIONr_symmetry_vdw_refined0.2350.248
X-RAY DIFFRACTIONr_symmetry_hbond_refined0.1440.227
X-RAY DIFFRACTIONr_mcbond_it1.4731.51059
X-RAY DIFFRACTIONr_mcangle_it2.2721665
X-RAY DIFFRACTIONr_scbond_it5.4343617
X-RAY DIFFRACTIONr_scangle_it5.1864.5541
X-RAY DIFFRACTIONr_rigid_bond_restr5.60731676
X-RAY DIFFRACTIONr_sphericity_free4.3953217
X-RAY DIFFRACTIONr_sphericity_bonded3.84131610
LS refinement shellResolution: 1.45→1.488 Å / Total num. of bins used: 20
RfactorNum. reflection% reflection
Rfree0.285 132 -
Rwork0.254 1571 -
obs--66.03 %

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more