| PDBID: | 8ymo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | OSCA1.1-F516A pre-open 1 | | Authors: | Zhang, M.F. | | Deposition date: | 2024-03-09 | | Release date: | 2025-03-09 |
|
| PDBID: | 9avn | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of CARD9 coiled-coil K156-K214 bound to Compound 1 | | Authors: | Raymond, D.D., Lemke, C.T. | | Deposition date: | 2024-03-04 |
|
| PDBID: | 8qpt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of pyrophosphatase from Ogataea parapolymorpha | | Authors: | Matyuta, I.O., Rodina, E.V., Vorobyeva, N.N., Kurilova, S.A., Bezpalaya, E.Y., Boyko, K.M. | | Deposition date: | 2023-10-03 | | Sequence: | >Entity 1
MLKLSRALSSVVSGTRNSPSFKTYLRLKDGKIGSFFHDVPLGLDKQKRIANMVVEIPRWVNAKYEISKDFKANPIVQDTKKGKLRYLNNIYPNHGVPHNYGAFPQTWESPLESSSLVNQNILGDNDPLDVIDIGRFVSSTGTVKPVKILGSLALVDDGELDWKVVVIDTNDPFAAELNDIKDVYEKMPGVLENLKRWFEVYKIPTGKEPNSFLFDGNYKDTEFTLKVVQECHENWYKLVMGELHGDNLPSTENATLPHTKGNTVFDVEIEVSQKAEQVPPEVNDMSFIK
|
|
| PDBID: | 8pk4 | | Status: | HPUB -- hold until publication | | Title: | Cryo EM structure of the type 5A polymorph of alpha-synuclein. | | Authors: | Frey, L., Qureshi, B.M., Kwiatkowski, W., Rhyner, D., Greenwald, J., Riek, R. | | Deposition date: | 2023-06-24 | | Sequence: | >Entity 1
(AME)DVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
|
|
| PDBID: | 8pk2 | | Status: | HPUB -- hold until publication | | Title: | Cryo EM structure of the type 1m polymorph of alpha-synuclein | | Authors: | Frey, L., Qureshi, B.M., Kwiatkowski, W., Rhyner, D., Greenwald, J., Riek, R. | | Deposition date: | 2023-06-24 | | Sequence: | >Entity 1
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
|
|
| PDBID: | 8pjo | | Status: | HPUB -- hold until publication | | Title: | Cryo EM structure of the type 3D polymorph of alpha-synuclein E46K mutant at low pH. | | Authors: | Frey, L., Qureshi, B.M., Kwiatkowski, W., Rhyner, D., Greenwald, J., Riek, R. | | Deposition date: | 2023-06-23 | | Sequence: | >Entity 1
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKKGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
|
|
| PDBID: | 8pix | | Status: | HPUB -- hold until publication | | Title: | Cryo EM structure of the type 3C polymorph of alpha-synuclein at low pH. | | Authors: | Frey, L., Qureshi, B.M., Kwiatkowski, W., Rhyner, D., Greenwald, J., Riek, R. | | Deposition date: | 2023-06-22 | | Sequence: | >Entity 1
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
|
|
| PDBID: | 8jte | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Amyloid-beta42-4b polymorph 1 | | Authors: | Xia, W.C., Liu, C. | | Deposition date: | 2023-06-21 | | Release date: | 2024-06-21 |
|
| PDBID: | 8jtf | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Amyloid-beta42-4b polymorph 2 | | Authors: | Xia, W.C., Liu, C. | | Deposition date: | 2023-06-21 | | Release date: | 2024-06-21 |
|
| PDBID: | 8jtg | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Amyloid-beta42-4b polymorph 3 | | Authors: | Xia, W.C., Liu, C. | | Deposition date: | 2023-06-21 | | Release date: | 2024-06-21 |
|
| PDBID: | 8pic | | Status: | HPUB -- hold until publication | | Title: | Cryo EM structure of the type 3B polymorph of alpha-synuclein at low pH. | | Authors: | Frey, L., Qureshi, B.M., Kwiatkowski, W., Rhyner, D., Greenwald, J., Riek, R. | | Deposition date: | 2023-06-21 | | Sequence: | >Entity 1
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
|
|
| PDBID: | 8hwv | | Status: | WDRN -- deposition withdrawn | | Title: | Cryo-EM structure of skin alpha-syn fibril polymorph1 | | Authors: | Xia, W.C., Liu, C. | | Deposition date: | 2023-01-03 | | Release date: | 2024-01-03 |
|
| PDBID: | 8hww | | Status: | WDRN -- deposition withdrawn | | Title: | Cryo-EM structure of skin alpha-syn fibril polymorph2 | | Authors: | Xia, W.C., Liu, C. | | Deposition date: | 2023-01-03 |
|
| PDBID: | 8hwx | | Status: | WDRN -- deposition withdrawn | | Title: | Cryo-EM structure of skin alpha-syn fibril polymorph3 | | Authors: | Xia, W.C., Liu, C. | | Deposition date: | 2023-01-03 |
|
| PDBID: | 8b2z | | Status: | WDRN -- deposition withdrawn | | Title: | Crystal structure of peptide amidase PAM-K123A mutant in complex with the competitive inhibitor chymostatin | | Authors: | Granzin, J. | | Deposition date: | 2022-09-15 |
|
| PDBID: | 6kwm | | Status: | WDRN -- deposition withdrawn | | Title: | The landscape of divergent peptide presentation leading by micropolymorphism in MHC I peptide-binding cleft | | Authors: | Wei, X.H., Wang, S., Zhang, N.Z., Xia, C. | | Deposition date: | 2019-09-07 |
|
| PDBID: | 5zcf | | Status: | WDRN -- deposition withdrawn | | Title: | Crystal structure of Plasmodium falciparum histo-aspartic protease (HAP) zymogen (Form 3) | | Authors: | Rathore, I., Mishra, V., Bhaumik, P. | | Deposition date: | 2018-02-17 |
|
| PDBID: | 5ymo | | Status: | WDRN -- deposition withdrawn | | Title: | Crystal Structure of Human NEIL1 (Y244R) bound to duplex DNA containing 2''-fluoro-2''-deoxy-5,6-dihydrouridine | | Authors: | Liu, M.H., Zhu, C.X., Zhang, J., Xiao, W.D., Gao, Y.Q., Yi, C.Q. | | Deposition date: | 2017-10-21 |
|
| PDBID: | 5jkh | | Status: | WDRN -- deposition withdrawn | | Title: | Synergistic and structural evidence for helix-bundle formation in an antimicrobial peptide against multidrug resistant Pseudomonas aeruginosa | | Authors: | He, R., Visini, R., Di Bonaventura, I., Robadey, M., Stach, M., Koehler, T., van Delden, C., Stocker, A., Darbre, T., Reymond, J.-L. | | Deposition date: | 2016-04-26 | | Release date: | 2017-10-26 |
|
| PDBID: | 5jko | | Status: | WDRN -- deposition withdrawn | | Title: | Synergistic and structural evidence for helix-bundle formation in an antimicrobial peptide against multidrug resistant Pseudomonas aeruginosa | | Authors: | He, R., Visini, R., Di Bonaventura, I., Robadey, M., Stach, M., Koehler, T., van Delden, C., Stocker, A., Darbre, T., Reymond, J.-L. | | Deposition date: | 2016-04-26 | | Release date: | 2017-10-26 |
|
| PDBID: | 5i7t | | Status: | WDRN -- deposition withdrawn | | Title: | Bicyclic antimicrobial peptides | | Authors: | Di Bonaventura, I., Jin, X., Visini, R., Michaud, G., Robadey, M., Koehler, T., van Delden, C., Stocker, A., Darbre, T., Reymond, J.-L. | | Deposition date: | 2016-02-18 | | Release date: | 2017-05-31 |
|
| PDBID: | 2mwu | | Status: | WDRN -- deposition withdrawn | | Title: | Solution Structure of DNA Dodecamer with 8-oxoguanine at 10th Position. | | Authors: | Gruber, D.R., Miears, H.L., Hoppins, J.J., Kiryutin, A., Kasymov, R., Zharkov, D.O., Smirnov, S.L. | | Deposition date: | 2014-11-26 |
|
| PDBID: | 4pq3 | | Status: | WDRN -- deposition withdrawn | | Title: | Crystal structure of the zymogen of cathepsin D from the tick Ixodes ricinus (IrCD1) | | Authors: | Brynda, J., Hanova, I., Mares, M. | | Deposition date: | 2014-02-28 |
|
| PDBID: | 4n89 | | Status: | WDRN -- deposition withdrawn | | Title: | Another flexible region at the active site of an inositol monophosphatase from Zymomonas mobilis | | Authors: | Hwang, H.J., Park, S.Y., Kim, J.S. | | Deposition date: | 2013-10-17 |
|
| PDBID: | 4in8 | | Status: | WDRN -- deposition withdrawn | | Title: | Crystal structure of recombinant BmKTT-2 in complex with bovine chymotrypsin | | Authors: | Zeng, F., Yang, W., Li, W., Wu, Y., Chen, Z. | | Deposition date: | 2013-01-04 |
|
