| PDBID: | 9dir | | Status: | PROC -- to be processed | | Title: | The crystal structure on the heme/hemoglobin transporter ChuA, in complex with heme | | Authors: | Fox, D., Venugopal, H., Lupton, C.J., Spicer, B.A., Grinter, R. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9dis | | Status: | PROC -- to be processed | | Title: | The crystal structure on the heme/hemoglobin transporter ChuA, in complex with heme | | Authors: | Fox, D., Venugopal, H., Lupton, C.J., Spicer, B.A., Grinter, R. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9dhe | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure on the heme/hemoglobin transporter ChuA, in complex with heme | | Authors: | Fox, D., Grinter, R. | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9iux | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of human hemoglobin subunit mu C49S/C104S mutant | | Authors: | Lin, Y.W. | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9bch | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the hemoglobin receptor HbpA from Corynebacterium diphtheriae | | Authors: | Mahoney, B.J., Clubb, R.T. | | Deposition date: | 2024-04-09 | | Sequence: | >Entity 1
SEEVKNADLYWGFSGSSHHKYDHNGPKFEKAGKGAELTNIDAASAYAETFKKGVFPNNKREKSDILVFHNGEVKTETNHSSYQINWPGEVTMKLGYGDGLVIKDLNLMLKNGNMGELKATVGENSNITLFDVQEYSVSDNTITVTPKIPPCTTGTWKPWHNDLTSKLGSLKSVFFESYTCNNDDIAKKPLPLTVVLNG
|
|
