| PDBID: | 9b4a | | Status: | HPUB -- hold until publication | | Title: | DNA Ligase 1 E346A/E592A double mutant with 3''ribo-8oxoG:A nick | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b4d | | Status: | HPUB -- hold until publication | | Title: | DNA Ligase 1 E346A/E592A double mutant with 3''deoxyribo-8oxoG:C nick | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b4b | | Status: | HPUB -- hold until publication | | Title: | DNA Ligase 1 E346A/E592A double mutant with 3''ribo-8oxoG:C nick | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b4c | | Status: | HPUB -- hold until publication | | Title: | DNA Ligase 1 E346A/E592A double mutant with 3''deoxyribo-8oxoG:A nick | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9epu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human CDKL5 kinase domain with compound CAF-382 | | Authors: | Richardson, W., Chen, X., Newman, J.A., Bakshi, S., Lakshminarayana, B., Brooke, L., Bullock, A.N. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9b3c | | Status: | HPUB -- hold until publication | | Title: | type 2 KD-mxyl filament of miniature tau macrocycle derived from 4R tauopathic fold | | Authors: | Xu, X., Angera, J.I., Rajewski, H.B., Jiang, W., Del Valle, R.J. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9ep8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ROCK2 in complex with a 8-(azaindolyl)-benzoazepinone inhibitor | | Authors: | Pala, D., Clark, D., Pioselli, B., Accetta, A., Rancati, F. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
| PDBID: | 8ypl | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric phosphomimetic mutant of Tribolium castaneum (Tc) PINK1 | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypn | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric autoinhibited Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+ | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypo | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+ | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypq | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric autoinhibited Tribolium castaneum (Tc) PINK1 L552R mutant | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Liu, Z., Mi, L.Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypp | | Status: | HPUB -- hold until publication | | Title: | Structure of the tetrameric trans-autophosphorylation complex of Tribolium castaneum (Tc) PINK1 | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Liu, Z., Mi, L.Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypm | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in prime-activation conformation | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypa | | Status: | HPUB -- hold until publication | | Title: | Human mitochondrial ClpP in complex with TR89 | | Authors: | Li, Q.-N., Sun, H.-Y., Xiao, Y.-B. | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9b2m | | Status: | HPUB -- hold until publication | | Title: | Hemagglutinin H1 New Caledonia 1999 in complex with monoclonal antibody Fab 43_S0008 | | Authors: | Torrents de la Pena, A., de Paiva Froes Rocha, R., Ward, A.B., Ataca, S., Kanekiyo, M. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eop | | Status: | HPUB -- hold until publication | | Title: | 270A Vipp1 dL10Ala helical tubes in the presence of EPL | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eou | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of the b1b2 domains from Human Neuropilin-1 in complex with a peptide. | | Authors: | Caing-Carlsson, R., Duelli, A., Walse, B. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eom | | Status: | HPUB -- hold until publication | | Title: | 250A Vipp1 dL10Ala helical tubes in the presence of EPL | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eon | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 270A Vipp1 dL10Ala helical tubes in the presence of EPL | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eoo | | Status: | HPUB -- hold until publication | | Title: | 260A Vipp1 dL10Ala helical tubes in the presence of EPL | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eo2 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of the adduct formed upon reaction of picoplatin with lysozyme (structure B) | | Authors: | Ferraro, G., Merlino, A. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b1x | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HWS19 strain gidB mutant mycobacterial ribosome | | Authors: | Chen, Y., Young, I.D., Fraser, J.S., Javid, B. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b1y | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | WT strain WT mycobacterial ribosome | | Authors: | Chen, Y., Young, I.D., Fraser, J.S., Javid, B. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b24 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | WT strain gidB mutant mycobacterial ribosome | | Authors: | Young, I.D., Chen, Y., Javid, B., Fraser, J.S. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9b1w | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HWS19 strain WT mycobacterial ribosome | | Authors: | Young, I.D., Chen, Y., Javid, B., Fraser, J.S. | | Deposition date: | 2024-03-14 |
|
