| PDBID: | 9bas | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_15A, a lambda-carrageenan specific sulfatase, in complex with galactose-6-sulfate | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8yxu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of CsoS1A/B (modeled with CsoS1A) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yy7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PtmB in complex with cyclo-(L-Trp-L-Trp) and Hypoxanthine | | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yxt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PtmB | | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | | Deposition date: | 2024-04-02 |
|
| PDBID: | 9evw | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Avian reovirus nonstructural protein sigmaNS | | Authors: | Kascakova, B., Tuma, R. | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8yww | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The structure of HKU1-B S protein with bsAb1 | | Authors: | Xia, L.Y., Zhang, Y.Y., Zhou, Q. | | Deposition date: | 2024-04-01 |
|
| PDBID: | 8ywu | | Status: | HPUB -- hold until publication | | Title: | Human PPAR alpha ligand binding domain in complex with a 1H-pyrazolo[3,4-b]pyridine-derived compound | | Authors: | Tachibana, K., Morie, T., Fukuda, S., Yuzuriha, T., Ishimoto, K., Nunomura, K., Lin, B., Miyachi, H., Oki, H., Kawahara, K., Meguro, K., Nakagawa, S., Tsujikawa, K., Akai, S., Doi, T., Yoshida, T. | | Deposition date: | 2024-04-01 |
|
| PDBID: | 8ywv | | Status: | HPUB -- hold until publication | | Title: | Human PPAR alpha ligand binding domain in complex with a 1H-pyrazolo[3,4-b]pyridine-derived compound | | Authors: | Tachibana, K., Morie, T., Fukuda, S., Yuzuriha, T., Ishimoto, K., Nunomura, K., Lin, B., Miyachi, H., Oki, H., Kawahara, K., Meguro, K., Nakagawa, S., Tsujikawa, K., Akai, S., Doi, T., Yoshida, T. | | Deposition date: | 2024-04-01 |
|
| PDBID: | 9b95 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the closed NF449-bound human P2X1 receptor | | Authors: | Felix, M.B., Alisa, G., Hariprasad, V., Jesse, I.M., David, M.T. | | Deposition date: | 2024-04-01 |
|
| PDBID: | 9b8m | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of ornithine decarboxylase in complex with a novel inhibitor | | Authors: | Schultz, C.R., Aleiwi, B., Zhou, X.E., Suino-Powell, K., Melcher, K., Brunzelle, J.S., Almeida, N.M.S., Wilson, A.K., Ellsworth, E., Bachmann, A.S. | | Deposition date: | 2024-03-31 |
|
| PDBID: | 9b8n | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of ornithine decarboxylase in complex with a novel inhibitor (10-S) | | Authors: | Schultz, C.R., Aleiwi, B., Zhou, X.E., Suino-Powell, K., Melcher, K., Brunzelle, J.S., Almeida, N.M.S., Wilson, A.K., Ellsworth, E., Bachmann, A.S. | | Deposition date: | 2024-03-31 |
|
| PDBID: | 9evo | | Status: | HPUB -- hold until publication | | Title: | Plasmodium falciparum apical membrane antigen 3D7 | | Authors: | Bentley, G.A., Saul, F.A., Vulliez-Le Normand, B. | | Deposition date: | 2024-03-31 |
|
| PDBID: | 9b8c | | Status: | HPUB -- hold until publication | | Title: | RM018 Fab in complex with Apex GT 6.2 trimer and RM20A3 Fab | | Authors: | Pratap, P.P., Ozorowski, G., Ward, A.B. | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9eve | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ARM domain of human ZNFX1 | | Authors: | Grabarczyk, D.B., Deszcz, L., Clausen, T. | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9ev3 | | Status: | HPUB -- hold until publication | | Title: | Corynebacterium glutamicum pyruvate:quinone oxidoreductase (PQO) purified from bacteria grown in acetate minimal medium | | Authors: | Da Silva Lameira, C., Muenssinger, S., Yang, L., Eikmanns, B.J., Bellinzoni, M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9ev4 | | Status: | HPUB -- hold until publication | | Title: | Pyruvate:quinone oxidoreductase (PQO) from Corynebacterium glutamicum CS176 | | Authors: | Da Silva Lameira, C., Muenssinger, S., Yang, L., Eikmanns, B.J., Bellinzoni, M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9ev5 | | Status: | HPUB -- hold until publication | | Title: | Corynebacterium glutamicum CS176 pyruvate:quinone oxidoreductase (PQO) in complex with FAD and thiamine diphosphate-magnesium ion | | Authors: | Da Silva Lameira, C., Muenssinger, S., Yang, L., Eikmanns, B.J., Bellinzoni, M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9ev6 | | Status: | HPUB -- hold until publication | | Title: | Corynebacterium glutamicum pyruvate:quinone oxidoreductase (PQO), C-terminal truncated construct | | Authors: | Da Silva Lameira, C., Muenssinger, S., Yang, L., Eikmanns, B.J., Bellinzoni, M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yub | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 ConSp RBD in complex with neutralizing antibody CC25.4 Fab | | Authors: | Kang, J.M., Yuan, M., Han, B.W., Wilson, I.A. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8yu8 | | Status: | HPUB -- hold until publication | | Title: | Human PPAR alpha ligand binding domain in complex with a 1H-pyrazolo[3,4-b]pyridine-derived compound | | Authors: | Tachibana, K., Morie, T., Fukuda, S., Yuzuriha, T., Ishimoto, K., Nunomura, K., Lin, B., Miyachi, H., Oki, H., Kawahara, K., Meguro, K., Nakagawa, S., Tsujikawa, K., Akai, S., Doi, T., Yoshida, T. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8yuc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 ConSp RBD in complex with antibodies PDI222 Fab and COVA1-16 Fab | | Authors: | Kang, J.M., Yuan, M., Han, B.W., Wilson, I.A. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8yuf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HEPN (Q64A) toxin | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9b73 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the desensitised ATP-bound human P2X1 receptor | | Authors: | Felix, M.B., Alisa, G., Hariprasad, V., Jesse, I.M., David, M.T. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9eu2 | | Status: | HPUB -- hold until publication | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 | | Sequence: | >Entity 1
MPAQPGYTPSADNLKARETFQDDKFGIFIHWGIYSMLADGEWVMHNKNLNWEEYAKLASGFYPAKFNAAEWVAAIKASGAKYITITSRHHDGFSMYATQQSDYNIVDATPFKRDVIHELADECRKQGIRLHLYYSHLDWRRDDYYPLGRTGKGTGRTTQGKWEDYCAFMNNQLTELLTNYGLIGAIWFDGMWDKDIYPDGMTAKTWNLNEQYTLIHRLQPACLIGNNHHITPFAGEDIQIFERDLPGENKAGLSGQDISRLPLETCETMNGMWGYKITDQDYKSTKILIQYLVKAAGKNANLLMNVGPQPNGELPTVAVQRLREMGEWMKIYAPTIQGTRGGVVTPRDWGVTTQKGKTLYVHVLNLDDKALFLPYAGNKLKSAVEYQSRKSVRFIQDRDGILLKFTDKPHSPDYVLELTFANELPLNLEHHHHHH
|
|
| PDBID: | 9eu3 | | Status: | HPUB -- hold until publication | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 | | Sequence: | >Entity 1
MPAQPGYTPSADNLKARETFQDDKFGIFIHWGIYSMLADGEWVMHNKNLNWEEYAKLASGFYPAKFNAAEWVAAIKASGAKYITITSRHHDGFSMYATQQSDYNIVDATPFKRDVIHELADECRKQGIRLHLYYSHLDWRRDDYYPLGRTGKGTGRTTQGKWEDYCAFMNNQLTELLTNYGLIGAIWFDGMWDKDIYPDGMTAKTWNLNEQYTLIHRLQPACLIGNNHHITPFAGEDIQIFERDLPGENKAGLSGQDISRLPLETCETMNGMWGYKITDQDYKSTKILIQYLVKAAGKNANLLMNVGPQPNGELPTVAVQRLREMGEWMKIYAPTIQGTRGGVVTPRDWGVTTQKGKTLYVHVLNLDDKALFLPYAGNKLKSAVEYQSRKSVRFIQDRDGILLKFTDKPHSPDYVLELTFANELPLNLEHHHHHH
|
|
