PDBID: | 9g5p | Status: | PROC -- to be processed | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 277K | Authors: | Horvath, D. | Deposition date: | 2024-07-17 |
|
PDBID: | 9isg | Status: | PROC -- to be processed | Title: | Structure of rat TRPV1 in complex with PSFL426-S5 | Authors: | Chen, X., Yu, Y. | Deposition date: | 2024-07-17 |
|
PDBID: | 9g4z | Status: | AUTH -- processed, waiting for author review and approval | Title: | TRPC5 in complex with photoswitch E-AzHC | Authors: | Porav, S.A., Bon, R., Muench, S. | Deposition date: | 2024-07-16 | Release date: | 2025-07-16 |
|
PDBID: | 9g50 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | TRPC5 in complex with photoswitch Z-AzHC | Authors: | Porav, S.A., Bon, R., Muench, S. | Deposition date: | 2024-07-16 | Release date: | 2025-07-16 |
|
PDBID: | 9g4y | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | TRPC5 in complex with photoswitch E-AzHC | Authors: | Porav, S.A., Bon, R., Muench, S. | Deposition date: | 2024-07-16 | Release date: | 2025-07-16 |
|
PDBID: | 9g2n | Status: | AUTH -- processed, waiting for author review and approval | Title: | Trp-cage fortified Tc5b-Exenatide chimera ( Ex-4-Tc5bDR) at 288K | Authors: | Horvath, D. | Deposition date: | 2024-07-11 |
|
PDBID: | 9g2o | Status: | AUTH -- processed, waiting for author review and approval | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex-4-Tc5bDR) at 299K | Authors: | Horvath, D. | Deposition date: | 2024-07-11 |
|
PDBID: | 9g31 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex-4-Tc5bDR) at 310K | Authors: | Horvath, D. | Deposition date: | 2024-07-11 |
|
PDBID: | 9g32 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex-4-Tc5bDR) at 321K | Authors: | Horvath, D. | Deposition date: | 2024-07-11 |
|
PDBID: | 9g22 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bDR) at 277K | Authors: | Daniel, H. | Deposition date: | 2024-07-10 |
|
PDBID: | 9g20 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 310K | Authors: | Daniel, H. | Deposition date: | 2024-07-10 |
|
PDBID: | 9g21 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 321K | Authors: | Daniel, H. | Deposition date: | 2024-07-10 |
|
PDBID: | 9clc | Status: | PROC -- to be processed | Title: | Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan | Authors: | Habel, E., Frkic, R.L., Jackson, C.J., Huber, T., Otting, G. | Deposition date: | 2024-07-10 |
|
PDBID: | 9g0m | Status: | AUTH -- processed, waiting for author review and approval | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 288K | Authors: | Daniel, H. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0n | Status: | AUTH -- processed, waiting for author review and approval | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 299K | Authors: | Daniel, H. | Deposition date: | 2024-07-08 |
|
PDBID: | 9blv | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Proteus vulgaris tryptophan indole-lyase complexed with L-Trp and benzimidazole | Authors: | Phillips, R.S. | Deposition date: | 2024-05-01 |
|
PDBID: | 9be7 | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP without Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-15 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
PDBID: | 9be8 | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant T49A/T52A dTRAP with Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-15 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFAEHASAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
PDBID: | 9bds | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP with Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-12 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
PDBID: | 8yza | Status: | HPUB -- hold until publication | Title: | Crystal structure of PtmB in complex with cyclo-(L-Trp-L-Trp) and Guanine | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | Deposition date: | 2024-04-06 |
|
PDBID: | 8yyp | Status: | HPUB -- hold until publication | Title: | Crystal structure of PtmB in complex with cyclo-(L-Trp-L-Trp) and Adenine | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | Deposition date: | 2024-04-04 |
|
PDBID: | 8yy7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of PtmB in complex with cyclo-(L-Trp-L-Trp) and Hypoxanthine | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | Deposition date: | 2024-04-03 |
|
PDBID: | 8yq2 | Status: | AUTH -- processed, waiting for author review and approval | Title: | ratTRPV1 bount with inhibitor AMG9810 | Authors: | Gao, Y.H., Li, Z.X. | Deposition date: | 2024-03-18 |
|
PDBID: | 9b1p | Status: | HPUB -- hold until publication | Title: | Mycolicibacterium smegmatis ClpS with TrpSer dipeptide and Mg2+ | Authors: | Presloid, C.J., Jiang, J., Beardslee, P.C., Anderson, H.R., Swayne, T.M., Schmitz, K.R. | Deposition date: | 2024-03-13 |
|
PDBID: | 8yh7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | ratTRPV1bount with inhibitor AMG517 | Authors: | Gao, Y.H., Li, Z.X. | Deposition date: | 2024-02-27 |
|