| PDBID: | 9fvr | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Transcription repressor NrdR from E. coli, ATP/dATP-bound state, SeMet protein | | Authors: | Bimai, O., Sjoberg, B.M., Rozman Grinberg, I., Logan, D.T. | | Deposition date: | 2024-06-28 |
|
| PDBID: | 9fm8 | | Status: | HPUB -- hold until publication | | Title: | Imine Reductase from Rhodococcus erythropolis | | Authors: | Domenech, J., Jongkind, E.P.J., Paul, C.E., Grogan, G. | | Deposition date: | 2024-06-05 |
|
| PDBID: | 9fm7 | | Status: | HPUB -- hold until publication | | Title: | Imine Reductase from Rhodococcus erythropolis | | Authors: | Domenech, J., Jongkind, E.P.J., Paul, C.E., Grogan, G. | | Deposition date: | 2024-06-05 |
|
| PDBID: | 8zom | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of pyraclostrobin-bound Arachis hypogaea bc1 complex | | Authors: | Cui, G.R., Wang, Y.X., Yang, G.F. | | Deposition date: | 2024-05-28 |
|
| PDBID: | 8zno | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Arachis hypogaea bc1 complex | | Authors: | Ye, Y., Dong, J.Q., Yang, G.F. | | Deposition date: | 2024-05-27 |
|
| PDBID: | 9bul | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The structure of NiaR from Thermotoga maritima bound to nicotinic acid | | Authors: | Glasfeld, A., Cheng, D.W.C., Li, Y. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9f7i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Borrelia burgdorferi B31 CspZ in complex with human FH SCR6-7 | | Authors: | Brangulis, K., Surth, V., Marcinkiewicz, A.L., Akopjana, I., Kazaks, A., Bogans, J., Huber, A., Lin, Y.-P., Kraiczy, P. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9f7k | | Status: | HPUB -- hold until publication | | Title: | Glutathione transferase epsilon 1 from Drosophila melanogaster in complex with glutathione | | Authors: | Didierjean, C., Schwartz, M., Neiers, F. | | Deposition date: | 2024-05-03 | | Sequence: | >Entity 1
MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYKEINEAPAQSYVAFLRSKWTKLGDK
|
|
| PDBID: | 9f08 | | Status: | HPUB -- hold until publication | | Title: | Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii. Covalent complex with 2-deoxyribose. | | Authors: | Ascham, A., Salihovic, A., Burley, G., Grogan, G. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9f09 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii. Complex with 2-deoxyribose, 7-Bromo-1H-imidazo[4,5-b]pyridine and 2''-deoxycytidine | | Authors: | Ascham, A., Salihovic, A., Burley, G., Grogan, G. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9ezk | | Status: | HPUB -- hold until publication | | Title: | Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii (apo). | | Authors: | Ascham, A., Salihovic, A., Burley, G., Grogan, G. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 9ba8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease | | Authors: | Hendle, J. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease | | Authors: | Hendle, J. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9euz | | Status: | HPUB -- hold until publication | | Title: | Glycoside hydrolase family 114 enzyme from Thermotoga maritima | | Authors: | Roth, C. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yue | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the kinesin-14 motor protein from Drosophila melanogaster | | Authors: | Wei, Y., Jobichen, C., Imasaki, T., Nitta, R., Wang, M.Y., Sivaraman, J., Endow, S.A. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8y9q | | Status: | HPUB -- hold until publication | | Title: | b-glucosidase from Thermotoga profunda Tp-BGL | | Authors: | Guo, Y., Chen, A. | | Deposition date: | 2024-02-07 |
|
| PDBID: | 8rxm | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Galectin-3 in complex with thiogalactoside derivative | | Authors: | Hakansson, M., Diehl, C., Peterson, K., Zetterberg, F., Nilsson, U. | | Deposition date: | 2024-02-07 |
|
| PDBID: | 8y1x | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the aspartate:alanine antiporter AspT WT | | Authors: | Nanatani, K., Kanno, R., Kawabata, T., Watanabe, S., Hidaka, M., Yamanaka, T., Toda, K., Fujiki, T., Kunii, K., Miyamoto, A., Chiba, F., Ogasawara, S., Murata, T., Humbel, B.M., Inaba, K., Mitsuoka, K., Guan, L., Abe, K., Yamamoto, M., Koshiba, S. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8xxk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the reaction intermediate derived from the crystal soaked into the solution at pH 4.0 under 298 K for 3 weeks | | Authors: | Unno, M., Koga, M., Miniwa, N., Komuro, S., Tanaka, Y. | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8xwc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the substrate 8-oxoguanine DNA at pH 8.0 under 277 K | | Authors: | Unno, M., Koga, M., Minowa, N., Komuro, S., Tanaka, Y. | | Deposition date: | 2024-01-16 |
|
| PDBID: | 8xwu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the reaction intermediate derived from the crystal soaked into the solution at pH 4.0 under 277 K for 24 hourss | | Authors: | Unno, M., Koga, M., Minowa, N., Komuro, S., Tanaka, Y. | | Deposition date: | 2024-01-16 |
|
| PDBID: | 8xua | | Status: | HPUB -- hold until publication | | Title: | Oligogalacturonate-specific porin from Vibrio harveyi (VhGalP) | | Authors: | Meesrikaew, P., Sanram, S., Robinson, R., Suginta, W. | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8rdc | | Status: | HPUB -- hold until publication | | Title: | Galectin-1 in complex with thiogalactoside derivative | | Authors: | Hakansson, M., Diehl, C., Peterson, K., Zetterberg, F., Nilsson, U. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8qpt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of pyrophosphatase from Ogataea parapolymorpha | | Authors: | Matyuta, I.O., Rodina, E.V., Vorobyeva, N.N., Kurilova, S.A., Bezpalaya, E.Y., Boyko, K.M. | | Deposition date: | 2023-10-03 | | Sequence: | >Entity 1
MLKLSRALSSVVSGTRNSPSFKTYLRLKDGKIGSFFHDVPLGLDKQKRIANMVVEIPRWVNAKYEISKDFKANPIVQDTKKGKLRYLNNIYPNHGVPHNYGAFPQTWESPLESSSLVNQNILGDNDPLDVIDIGRFVSSTGTVKPVKILGSLALVDDGELDWKVVVIDTNDPFAAELNDIKDVYEKMPGVLENLKRWFEVYKIPTGKEPNSFLFDGNYKDTEFTLKVVQECHENWYKLVMGELHGDNLPSTENATLPHTKGNTVFDVEIEVSQKAEQVPPEVNDMSFIK
|
|
| PDBID: | 8kct | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human gamma-secretase in complex with Nirogacestat | | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | | Deposition date: | 2023-08-08 |
|
