| PDBID: | 9dvf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the native PLP synthase subunit PdxS from Methanosarcina acetivorans | | Authors: | Agnew, A., Humm, E., Zhou, K., Gunsalus, R., Zhou, Z.H. | | Deposition date: | 2024-10-07 |
|
| PDBID: | 9dp6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Mycolicibacterium smegmatis MmpL5-AcpM structure | | Authors: | Maharjan, R., Klenotic, P.A., Zhang, Z., Yu, E.W. | | Deposition date: | 2024-09-20 |
|
| PDBID: | 9dla | | Status: | HPUB -- hold until publication | | Title: | Streptococcus pneumoniae GAPN with NADP+ | | Authors: | Eunjeong, L., Elan, Z.E. | | Deposition date: | 2024-09-10 |
|
| PDBID: | 9dlc | | Status: | HPUB -- hold until publication | | Title: | Streptococcus pneumoniae GAPN with G3P | | Authors: | Eunjeong, L., Elan, Z.E. | | Deposition date: | 2024-09-10 |
|
| PDBID: | 9dlb | | Status: | HPUB -- hold until publication | | Title: | Streptococcus pneumoniae apo GAPN | | Authors: | Eunjeong, L., Elan, Z.E. | | Deposition date: | 2024-09-10 |
|
| PDBID: | 9d62 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Human Galectin-3 CRD in complex with Lactose (native) | | Authors: | dos Santos, L.V., Dias, I.P., Mazepa, E., Minella, T.F., Baruffi, M.R., Mestriner, L., Nascimento, A.F.Z., Albuquerque, L.J.C., Mischiatti, K.L., Winnischofer, S.M.B., Amaral, S.S., Silveira, J.L.M., Picheth, G.F. | | Deposition date: | 2024-08-14 |
|
| PDBID: | 9d63 | | Status: | PROC -- to be processed | | Title: | Crystal structure of Human Galectin-3 CRD in complex with Galactose (Galactose soak) | | Authors: | dos Santos, L.V., Dias, I.P., Mazepa, E., Minella, T.F., Baruffi, M.R., Mestriner, L., Nascimento, A.F.Z., Albuquerque, L.J.C., Mischiatti, K.L., Winnischofer, S.M.B., Amaral, S.S., Silveira, J.L.M., Picheth, G.F. | | Deposition date: | 2024-08-14 |
|
| PDBID: | 9d64 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Human Galectin-3 CRD in complex with Galacturonic acid (Galacturonic acid soak) | | Authors: | dos Santos, L.V., Dias, I.P., Mazepa, E., Minella, T.F., Baruffi, M.R., Mestriner, L., Nascimento, A.F.Z., Albuquerque, L.J.C., Mischiatti, K.L., Winnischofer, S.M.B., Amaral, S.S., Silveira, J.L.M., Picheth, G.F. | | Deposition date: | 2024-08-14 |
|
| PDBID: | 9iiq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of 117 Fab-E complex | | Authors: | Zhao, H., Deng, Z. | | Deposition date: | 2024-06-21 |
|
| PDBID: | 9iiz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of EfPiwi-piRNA-target (25-nt, comma) | | Authors: | Li, Z.Q., Xu, Q.K., Wu, J.P., Shen, E.Z. | | Deposition date: | 2024-06-21 |
|
| PDBID: | 9c8d | | Status: | HPUB -- hold until publication | | Title: | mouse Seipin/Adig complex | | Authors: | Li, C., Han, Y., Wynn, R.M., Chen, Z., Scherer, P.E. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 9c8e | | Status: | HPUB -- hold until publication | | Title: | mouse Seipin complex | | Authors: | Li, C., Han, Y., Wynn, R.M., Chen, Z., Scherer, P.E. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8z7g | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 S trimer in the early fusion intermediate conformation (E-FIC) (focused refinement of intact S2) | | Authors: | Liu, Z., Xing, L. | | Deposition date: | 2024-04-20 |
|
| PDBID: | 8z7l | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 S trimer in the early fusion intermediate conformation (E-FIC) (focused refinement of S-bottom) | | Authors: | Liu, Z., Xing, L. | | Deposition date: | 2024-04-20 |
|
| PDBID: | 8z7p | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 S trimer in the early fusion intermediate conformation (E-FIC) | | Authors: | Liu, Z., Xing, L. | | Deposition date: | 2024-04-20 |
|
| PDBID: | 8z7b | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 S trimer in the early fusion intermediate conformation (E-FIC) (focused refinement of NTD-SD1-RBD-ACE2) | | Authors: | Liu, Z., Xing, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9aw5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Yeast 20S proteasome soaked with MA9 fraction E/F | | Authors: | Meneghello, R., Rustiguel, J.K., Fernandes, A.Z.N., Trivella, D.B.B. | | Deposition date: | 2024-03-05 |
|
| PDBID: | 9au7 | | Status: | HPUB -- hold until publication | | Title: | Human Retriever VPS35L/VPS29/VPS26C complex bound to SNX17 peptide (Composite Map) | | Authors: | Chen, B., Chen, Z., Han, Y., Boesch, D.J., Juneja, P., Burstein, E., Fung, H.Y.J. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8vxl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of the External Aldimine Complex of Pyridoxal-5''-Tetrazole and (S)-4-amino-5-phenoxypentanoate with the Bacillus subtilis GabR C-terminal Effector-binding and Oligomerization Domain | | Authors: | Kaley, N.E., Liveris, Z.J., Becker, D.P., Liu, D. | | Deposition date: | 2024-02-05 |
|
| PDBID: | 8vwf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Anisomycin-induced collided mammalian ribosomes | | Authors: | Loerch, S., Petrossian, E., Smith, P.R., Campbell, Z.T. | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8vvp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Codon sampling state obtained from Anisomycin-treated mammalian ribosomes | | Authors: | Loerch, S., Petrossian, E., Smith, P.R., Campbell, Z.T. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8vvu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Anisomycin-bound mammalian ribosome with partially accommodated A-site tRNA | | Authors: | Loerch, S., Petrossian, E., Smith, P.R., Campbell, Z.T. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8rmy | | Status: | HPUB -- hold until publication | | Title: | Transglutaminase 3 in complex with inhibitor Z-don and DH patient-derived Fab DH63-A02 | | Authors: | Heggelund, J.E., Sollid, L.M. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rcx | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of the Mycobacterium tuberculosis regulator VirS (N-terminal fragment 4-208) in complex with the drug candidate alpibectir | | Authors: | Edoo, Z., Frita, R., Grosse, C., Bourotte, M., Moune, M., Antoine, R., Trebosc, V., Schellhorn, B., Dreneau, A., Hofmann, L., Kemmer, C., Lociuro, S., Dale, G.E., Jung, F., Perez-Herran, E., Mendoza, A., Rebollo Lopez, M.J., Ghidelli-Disse, S., Drewes, G., Mathys, V., Soetaert, K., Megalizzi, V., Wintjens, R., Barros Aguirre, D., Remuinan, M.D., Gitzinger, M., Deprez, B., Willand, N., Pieren, M., Baulard, A.R. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8r27 | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with (Z)-4-(1-cyano-2-(4-hydroxyphenyl)vinyl)benzoic acid and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-11-03 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
