| PDBID: | 9p4g | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of Flagellar Assembly Protein FliW from Campylobacter jejuni subsp. jejuni 81-176-DRH212 | | Authors: | Minasov, G., Shuvalova, L., Wawrzak, Z., Kiryukhina, O., Satchell, K.J.F., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-06-16 | | Release date: | 2026-06-16 |
|
| PDBID: | 9p1q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ube2E3 | | Authors: | Cook, M.W., Brzovic, P.S., Stenkamp, R.E. | | Deposition date: | 2025-06-10 | | Sequence: | >Entity 1
MTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
|
|
| PDBID: | 9p13 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Lysozyme in situ room temperature on site | | Authors: | Snell, M.E., Campomizzi, C.S., Mikolajek, H., Sandy, J., Sanchez-Weatherby, J., Budziszewski, G.R., Hough, M.A., Bowman, S.E.J. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p16 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Thermolysin Room-Temperature In-Situ | | Authors: | Campomizzi, C.S., Snell, M.E., Mikolajek, H., Sandy, J., Sanchez-Weatherby, J., Budziszewski, G.R., Hough, M.A., Bowman, S.E.J. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p17 | | Status: | HPUB -- hold until publication | | Title: | Thermolysin Room-Temperature In-Situ | | Authors: | Campomizzi, C.S., Snell, M.E., Mikolajek, H., Sandy, J., Sanchez-Weatherby, J., Budziszewski, G.R., Hough, M.A., Bowman, S.E.J. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9vd1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Dimeric Suv3-ssRNA-AMPPNP complex | | Authors: | Patra, M., Yuan, H.S. | | Deposition date: | 2025-06-07 |
|
| PDBID: | 9vd0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of monomeric Suv3-ssRNA-AMPPNP complex | | Authors: | Patra, M., Yuan, H.S. | | Deposition date: | 2025-06-07 |
|
| PDBID: | 7ifn | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal A02a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 7ifo | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal A03a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 7ifp | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal A04a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 7ifq | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal A05a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 7ifr | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal A06a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 7ifs | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal A08a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 7ift | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal A09a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 7ifu | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal A10a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 7ifv | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal A12a from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 7ifw | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal Apo01 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 7ifx | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal Apo02 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 7ify | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal Apo03 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 7ifz | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal Apo04 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 7ig0 | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal Apo05 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 7ig1 | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal Apo06 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 7ig2 | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal Apo07 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 7ig3 | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal Apo08 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
| PDBID: | 7ig4 | | Status: | PROC -- to be processed | | Title: | Endothiapepsin crystal Apo09 from ECBL-96 fragment library screening campaign used for PanDDA ground state calculation | | Authors: | Wollenhaupt, J., Benz, L.S., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-05 |
|
