| PDBID: | 8yc8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cyanophage Pan5 baseplate | | Authors: | Zhu, J., Li, Q., Zhou, C.Z. | | Deposition date: | 2024-02-17 |
|
| PDBID: | 8yc1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Acid phosphate hydrolase from Shigella flexneri (apo) | | Authors: | Du, W.Y., Pan, X.M., Dong, L.B. | | Deposition date: | 2024-02-17 |
|
| PDBID: | 8yc3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cyanophage Pan5 portal-adaptor | | Authors: | Zhu, J., Li, Q., Zhou, C.Z. | | Deposition date: | 2024-02-17 |
|
| PDBID: | 8yc4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cyanophage Pan5 terminator | | Authors: | Zhu, J., Li, Q., Zhou, C.Z. | | Deposition date: | 2024-02-17 |
|
| PDBID: | 8yc6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cyanophage Pan5 straight tail tube | | Authors: | Zhu, J., Li, Q., Zhou, C.Z. | | Deposition date: | 2024-02-17 |
|
| PDBID: | 8yc7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cyanophage Pan5 bent tail tube | | Authors: | Zhu, J., Li, Q., Zhou, C.Z. | | Deposition date: | 2024-02-17 |
|
| PDBID: | 8s0v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Cryptosporidium parvum - Trypanosoma cruzi mutant lysyl tRNA synthetase in complex with inhibitor | | Authors: | Dawson, A., Wyllie, S. | | Deposition date: | 2024-02-14 |
|
| PDBID: | 8rvr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Trypanosoma congolense pyruvate kinase in complex with a single-domain antibody (TcoPYK-sdAb42) in the presence of sulfate | | Authors: | Sterckx, Y.G.-J. | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rtf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Trypanosoma congolense pyruvate kinase in complex with a single-domain antibody (TcoPYK-sdAb42) | | Authors: | Sterckx, Y.G.-J. | | Deposition date: | 2024-01-26 |
|
| PDBID: | 8y1t | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF TRYPANOSOMA BRUCEI GAMBIENSE GLYCEROL KINASE COMPLEX WITH ADP and G3P | | Authors: | Balogun, E.O., Inaoka, D.K., Ichinose, M., Chishima, T., Harada, S., Kita, K., Shiba, T. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8vs7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ADI-19425 Fab in complex with anti-idiotypic 2C1 Fab | | Authors: | Kher, G., Homad, L.J., McGuire, A.T., Pancera, M. | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vs8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ADI-19425 Fab in complex with anti-idiotypic 1D3 Fab | | Authors: | Kher, G., Homad, L.J., McGuire, A.T., Pancera, M. | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vqf | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of natural Can f 1 in complex with human IgE 1J11 Fab | | Authors: | Khatri, K., Ball, A., Richardson, C.M., Smith, S.A., Champan, M.D., Pomes, A., Chruszcz, M. | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8vqg | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of Can f 1 | | Authors: | Khatri, K., Geoffrey, M.A., Pedersen, L.C., Champan, M.D., Pomes, A., Chruszcz, M. | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8xsc | | Status: | HOLD -- hold until a certain date | | Title: | PPAT in complex with Ppant | | Authors: | Yin, H.S. | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8rib | | Status: | HPUB -- hold until publication | | Title: | N-terminal domain of Trypanosoma brucei PEX14 in complex with a pyrazolo-pyrazolo[4,3-c]pyridin-3-yl compound showing a novel binding pose | | Authors: | Napolitano, V., Janna Olmos, J., Popowicz, G.M., Dubin, G. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8rhy | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P34 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8rhv | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P30 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8rhu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P25 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8rhw | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P31 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8rhx | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P32 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8rht | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei DHFR in complex with the cofactor and inhibitor P25 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
GSHMLSLTRILRKKIPVHELAGKISRPPLRPFSVVVASDEKGGIGDGGTIPWEIPEDMQYFRRVTTNLRGKNVKPSPSKRNAVVMGRKTWDSLPPKFRPLSNRLNVVLSRSATKEQLLAGIPDPIKRAEAANDVVAVNGGLEDALRMLVSKEHTSSIETVFCIGGGTIYKQALCAPCVNVLQAIHRTVVRPASNSCSVFFDIPAAGTKTPEGLELVRESITDERVSTGAGGKKYQFEKLVPRNS
|
|
| PDBID: | 8vdl | | Status: | HPUB -- hold until publication | | Title: | HB3VAR03 CIDRa1.4 domain with C7 Fab | | Authors: | Hurlburt, N.K., Pancera, M. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8uy5 | | Status: | HPUB -- hold until publication | | Title: | [ZP] Self-assembling DNA crystal with expanded genetic code using C,A,T,G, Z and P nucleotides | | Authors: | Vecchioni, S., Sha, R., Ohayon, Y.P., Hernandez, C. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8wza | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human pannexin 3 in nanodisc | | Authors: | Hang, Z., Huawei, Z., Daping, W. | | Deposition date: | 2023-11-01 |
|
