| PDBID: | 9gcp | | Status: | HPUB -- hold until publication | | Title: | ChREBP/14-3-3 complex stabilized by AMP | | Authors: | Moschref, M., Heimhalt, M., Pysik, T., Menzer, W.M., Basquin, J., Margulies, C.E., Ladurner, A.G. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcs | | Status: | HPUB -- hold until publication | | Title: | Rho-ATP-Psu complex II | | Authors: | Gjorgjevikj, D., Wahl, M.C., Hilal, T., Loll, B. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gct | | Status: | HPUB -- hold until publication | | Title: | Rho-ATP-Psu complex II expanded | | Authors: | Gjorgjevikj, D., Wahl, M.C., Hilal, T., Loll, B. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcu | | Status: | HPUB -- hold until publication | | Title: | Rho-P167L-ATP gamma S | | Authors: | Gjorgjevikj, D., Wahl, M.C., Hilal, T., Loll, B. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gc1 | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND8 | | Authors: | Schaefer, M., Fuerstner, C. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQRNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
|
|
| PDBID: | 9gc9 | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND27 | | Authors: | Schaefer, M., Fuerstner, C. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQRNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
|
|
| PDBID: | 9gcc | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND47 | | Authors: | Schaefer, M., Fuerstner, C. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQRNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
|
|
| PDBID: | 9gcd | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH Fulacimstat (COMPOUND86) | | Authors: | Schaefer, M., Fuerstner, C. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQRNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN
|
|
| PDBID: | 9iz9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | VLP structure of Chikungunya virus complexed with C37 Fab, 2f block. | | Authors: | Han, X., Ji, C., Wang, F., Tian, S., Gao, F.G., Yan, J. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy8 | | Status: | HPUB -- hold until publication | | Title: | Constrained b-hairpins targeting the EphA4 ligand binding domain | | Authors: | Muzzarelli, K.M., Assar, Z., Prentis, A.M., Baggio, C., Pellecchia, M. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gbm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Angiotensin-1 converting enzyme C-domain in complex with a diprolyl inhibitor- SG3 | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Angiotensin-1 converting enzyme C-domain in complex with a diprolyl inhibitor- SG15 | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Angiotensin-1 converting enzyme C-domain in complex with a diprolyl inhibitor- SG16 | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbh | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND1 | | Authors: | Schaefer, M., Fuerstner, C., Ackerstaff, J., Meier, H., Straub, A., Mittendorf, J., Schamberger, J., Boerngen, K., Joerissen, H., Zubow, D., Zimmermann, K., Tersteegen, A., Geiss, V., Hartmann, E., Albrecht-Kuepper, B., Dorleans-Juste, P., Lapointe, C., Vincent, L., Heitmeier, S., Tinel, H. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbe | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Human Anaplastic Lymphoma Kinase (ALK) harboring the G1202R/L1196M Compound Mutation in Complex with NVL-655 | | Authors: | Mente, S., Horan, J.C. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iz1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | dmCTPS tetramer with dATP dUTP dGTP and DON | | Authors: | Guo, C.J., Liu, J.L. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iz2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Focus refinement dmCTPS bound with dATP dUTP dGTP and DON | | Authors: | Guo, C.J., Liu, J.L. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Complement Factor H central CCP domains 8-14 in complex with the cyclic peptide 5C6 | | Authors: | Monecke, T., Schmidt, C.Q., Niessing, D. | | Deposition date: | 2024-07-30 |
|
| PDBID: | 9iyd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of an amyloid fibril formed by SOD1 mutant - G93A | | Authors: | Zhang, M.Y., Ma, Y.Y., Wang, L.Q., Xia, W.C., Yuan, H.Y., Zhao, K., Chen, J., Li, D., Zou, L.Y., Wang, Z.Z., Liu, C., Liang, Y. | | Deposition date: | 2024-07-30 |
|
| PDBID: | 9iyi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | VLP structure of Chikungunya virus complexed with C34 Fab, 2f block. | | Authors: | Han, X., Ji, C., Wang, F., Tian, S., Gao, F.G., Yan, J. | | Deposition date: | 2024-07-30 |
|
| PDBID: | 9iyj | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of an amyloid fibril formed by SOD1 mutant - D101N | | Authors: | Zhang, M.Y., Ma, Y.Y., Wang, L.Q., Xia, W.C., Yuan, H.Y., Zhao, K., Chen, J., Li, D., Zou, L.Y., Wang, Z.Z., Liu, C., Liang, Y. | | Deposition date: | 2024-07-30 |
|
| PDBID: | 9gah | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Complement Factor H central CCP domains 8-14 | | Authors: | Monecke, T., Schmidt, C.Q., Niessing, D. | | Deposition date: | 2024-07-29 |
|
| PDBID: | 9ixn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OXA-10 | | Authors: | Lee, C.E., Park, Y.S., Park, H.J., Kang, L.W. | | Deposition date: | 2024-07-29 |
|
| PDBID: | 9ixo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OXA-14 | | Authors: | Lee, C.E., Park, Y.S., Park, H.J., Kang, L.W. | | Deposition date: | 2024-07-29 |
|
| PDBID: | 9ixr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OXA-10 variant A124T in the complex with ceftazidime | | Authors: | Lee, C.E., Park, Y.S., Park, H.J., Kang, L.W. | | Deposition date: | 2024-07-29 |
|
