PDBID: | 9b4a | Status: | HPUB -- hold until publication | Title: | DNA Ligase 1 E346A/E592A double mutant with 3''ribo-8oxoG:A nick | Authors: | KanalElamparithi, B., Caglayan, M. | Deposition date: | 2024-03-20 |
|
PDBID: | 9b4b | Status: | HPUB -- hold until publication | Title: | DNA Ligase 1 E346A/E592A double mutant with 3''ribo-8oxoG:C nick | Authors: | KanalElamparithi, B., Caglayan, M. | Deposition date: | 2024-03-20 |
|
PDBID: | 9epu | Status: | HPUB -- hold until publication | Title: | Crystal structure of the human CDKL5 kinase domain with compound CAF-382 | Authors: | Richardson, W., Chen, X., Newman, J.A., Bakshi, S., Lakshminarayana, B., Brooke, L., Bullock, A.N. | Deposition date: | 2024-03-20 |
|
PDBID: | 9b3c | Status: | HPUB -- hold until publication | Title: | type 2 KD-mxyl filament of miniature tau macrocycle derived from 4R tauopathic fold | Authors: | Xu, X., Angera, J.I., Rajewski, H.B., Jiang, W., Del Valle, R.J. | Deposition date: | 2024-03-18 |
|
PDBID: | 9ep8 | Status: | HPUB -- hold until publication | Title: | Crystal structure of ROCK2 in complex with a 8-(azaindolyl)-benzoazepinone inhibitor | Authors: | Pala, D., Clark, D., Pioselli, B., Accetta, A., Rancati, F. | Deposition date: | 2024-03-18 | Sequence: | >Entity 1 GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
PDBID: | 8ypq | Status: | HPUB -- hold until publication | Title: | Structure of dimeric autoinhibited Tribolium castaneum (Tc) PINK1 L552R mutant | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Liu, Z., Mi, L.Z. | Deposition date: | 2024-03-17 |
|
PDBID: | 8ypn | Status: | HPUB -- hold until publication | Title: | Structure of dimeric autoinhibited Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+ | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., liu, Z. | Deposition date: | 2024-03-17 |
|
PDBID: | 8ypo | Status: | HPUB -- hold until publication | Title: | Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+ | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z. | Deposition date: | 2024-03-17 |
|
PDBID: | 8ypl | Status: | HPUB -- hold until publication | Title: | Structure of dimeric phosphomimetic mutant of Tribolium castaneum (Tc) PINK1 | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z. | Deposition date: | 2024-03-17 |
|
PDBID: | 8ypp | Status: | HPUB -- hold until publication | Title: | Structure of the tetrameric trans-autophosphorylation complex of Tribolium castaneum (Tc) PINK1 | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Liu, Z., Mi, L.Z. | Deposition date: | 2024-03-17 |
|
PDBID: | 8ypm | Status: | HPUB -- hold until publication | Title: | Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in prime-activation conformation | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z. | Deposition date: | 2024-03-17 |
|
PDBID: | 8ypa | Status: | HPUB -- hold until publication | Title: | Human mitochondrial ClpP in complex with TR89 | Authors: | Li, Q.-N., Sun, H.-Y., Xiao, Y.-B. | Deposition date: | 2024-03-16 |
|
PDBID: | 9b2m | Status: | HPUB -- hold until publication | Title: | Hemagglutinin H1 New Caledonia 1999 in complex with monoclonal antibody Fab 43_S0008 | Authors: | Torrents de la Pena, A., de Paiva Froes Rocha, R., Ward, A.B., Ataca, S., Kanekiyo, M. | Deposition date: | 2024-03-15 |
|
PDBID: | 9eou | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of the b1b2 domains from Human Neuropilin-1 in complex with a peptide. | Authors: | Caing-Carlsson, R., Duelli, A., Walse, B. | Deposition date: | 2024-03-15 |
|
PDBID: | 9eon | Status: | AUTH -- processed, waiting for author review and approval | Title: | 270A Vipp1 dL10Ala helical tubes in the presence of EPL | Authors: | Junglas, B., Sachse, C. | Deposition date: | 2024-03-15 |
|
PDBID: | 9eoo | Status: | HPUB -- hold until publication | Title: | 260A Vipp1 dL10Ala helical tubes in the presence of EPL | Authors: | Junglas, B., Sachse, C. | Deposition date: | 2024-03-15 |
|
PDBID: | 9eop | Status: | HPUB -- hold until publication | Title: | 270A Vipp1 dL10Ala helical tubes in the presence of EPL | Authors: | Junglas, B., Sachse, C. | Deposition date: | 2024-03-15 |
|
PDBID: | 9eom | Status: | HPUB -- hold until publication | Title: | 250A Vipp1 dL10Ala helical tubes in the presence of EPL | Authors: | Junglas, B., Sachse, C. | Deposition date: | 2024-03-15 |
|
PDBID: | 9b1x | Status: | AUTH -- processed, waiting for author review and approval | Title: | HWS19 strain gidB mutant mycobacterial ribosome | Authors: | Chen, Y., Young, I.D., Fraser, J.S., Javid, B. | Deposition date: | 2024-03-14 |
|
PDBID: | 9b1w | Status: | AUTH -- processed, waiting for author review and approval | Title: | HWS19 strain WT mycobacterial ribosome | Authors: | Young, I.D., Chen, Y., Javid, B., Fraser, J.S. | Deposition date: | 2024-03-14 |
|
PDBID: | 9b1y | Status: | AUTH -- processed, waiting for author review and approval | Title: | WT strain WT mycobacterial ribosome | Authors: | Chen, Y., Young, I.D., Fraser, J.S., Javid, B. | Deposition date: | 2024-03-14 |
|
PDBID: | 9b24 | Status: | AUTH -- processed, waiting for author review and approval | Title: | WT strain gidB mutant mycobacterial ribosome | Authors: | Young, I.D., Chen, Y., Javid, B., Fraser, J.S. | Deposition date: | 2024-03-14 |
|
PDBID: | 9b2b | Status: | HPUB -- hold until publication | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with a Complete Estrogen Receptor Antagonists that Favors Tetramer Formation | Authors: | Fink, E.C., Chawla, R., Wells, K.S., Barratt, S., Myles, D.C., Pena, G., Robello, B.W., Ng, R., Fanning, S.W. | Deposition date: | 2024-03-14 |
|
PDBID: | 9eo3 | Status: | HPUB -- hold until publication | Title: | Crystal structure of tyrosinase (WT) from Bacillus megaterium soaked in Cu(II) | Authors: | Englund, A.N.B., Rohr, A.K., Dalleywater, E.L. | Deposition date: | 2024-03-14 |
|
PDBID: | 9b15 | Status: | HPUB -- hold until publication | Title: | Superfamily 2 helicase Hel308 containing the beta-hairpin from DNA pol theta helicase-like domain | Authors: | Eckenroth, B.E., Doublie, S. | Deposition date: | 2024-03-13 |
|