| PDBID: | 9znm | | Status: | HPUB -- hold until publication | | Title: | WNK1/SA kinase domain in complex with potassium formate at 1 Angstrom wavelength | | Authors: | Goldsmith, E.J., Akella, R. | | Deposition date: | 2025-12-13 | | Sequence: | >Entity 1
QEERNQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKAVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQE
|
|
| PDBID: | 21ho | | Status: | HPUB -- hold until publication | | Title: | Crystal strucrue of HuHF-C2-MEO complex | | Authors: | Gong, W.J., Wang, W.M., Wang, H.F. | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21hg | | Status: | HPUB -- hold until publication | | Title: | BceAB dimer IF peptidisc sample | | Authors: | He, Y.T., Luo, M. | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21hm | | Status: | HPUB -- hold until publication | | Title: | BceAB dimer OF peptidisc sample | | Authors: | He, Y.T., Luo, M. | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21hu | | Status: | HPUB -- hold until publication | | Title: | BceAB dimer IF peptidisc sample | | Authors: | He, Y.T., Luo, M. | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21hv | | Status: | HPUB -- hold until publication | | Title: | BceAB dimer CHS-bound OF peptidisc sample | | Authors: | He, Y.T., Luo, M. | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21hw | | Status: | HPUB -- hold until publication | | Title: | BceAB dimer CHS-bound IF-1 peptidisc sample | | Authors: | He, Y.T., Luo, M. | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21hy | | Status: | HPUB -- hold until publication | | Title: | BceAB dimer ATP-gamma-S bound peptidisc sample | | Authors: | He, Y.T., Luo, M. | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21hz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BceAB dimer vanadate sample | | Authors: | He, Y.T., Luo, M. | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21gu | | Status: | HOLD -- hold until a certain date | | Title: | OleP in complex with lithocholic acid | | Authors: | Zhou, J.H., Pang, C.P. | | Deposition date: | 2025-12-12 | | Release date: | 2026-06-12 |
|
| PDBID: | 21hq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Ryanodine receptor 1 (RyR1-S0-20uM [Ca2+], open) | | Authors: | Risheng, W., Qiang, C., Lei, Z., Chuang, L., Chang-Cheng, Y., Hongli, H. | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21ft | | Status: | PROC -- to be processed | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21hr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structural of taurocholic acid bound OST alpha/beta transporter | | Authors: | Xu, K., Hou, W.T. | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21hh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Mtb PKS13 Thioesterase domain in complex with inhibitor 5b | | Authors: | Fang, Y.Y., Wu, L.Y., Zhang, W., Peng, W. | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21gw | | Status: | HPUB -- hold until publication | | Title: | PA-mNeonGreen OFF, a kindling version of the mNeonGreen fluorescent protein in a dark (non-fluorescent) state | | Authors: | Boyko, K.M., Nikolaeva, A.Y., Kuzmicheva, T.P., Subach, O.M., Popov, V.O., Subach, F.V. | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21gv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21gy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21he | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21gz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21hf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21ha | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21gx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21hn | | Status: | PROC -- to be processed | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21hc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-12-12 |
|
| PDBID: | 21hd | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-12-12 |
|
