PDBID: | 9g3c | Status: | HPUB -- hold until publication | Title: | Crystal Structure of the artificial protein METP in complex with cadmium ion at different temperatures. 200 K data collection | Authors: | Di Costanzo, L., La Gatta, S., Chino, M. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3o | Status: | HOLD -- hold until a certain date | Title: | Circularly permuted lumazine synthase 24-pentamer spherical cage | Authors: | Koziej, L., Azuma, Y. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9g3p | Status: | HOLD -- hold until a certain date | Title: | Circularly permuted lumazine synthase 12-pentamer spherical cage | Authors: | Koziej, L., Azuma, Y. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9g3u | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of the artificial protein METP in complex with cadmium ion at different temperatures. Room temperature data collection | Authors: | Di Costanzo, L., La Gatta, S., Chino, M. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g41 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g42 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3k | Status: | HPUB -- hold until publication | Title: | LecB from PA01 in complex with synthetic beta - fucosylamide | Authors: | Antonini, G., Varrot, A. | Deposition date: | 2024-07-12 | Sequence: | >Entity 1 ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
|
|
PDBID: | 9g40 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3z | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the Open gamma-Tubulin Ring Complex from Pig Brain | Authors: | Munoz-Hernandez, H., Wieczorek, M. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3q | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9ipz | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of YEATS domain of human YEATS2 in complex with H3K27bf peptide | Authors: | Yao, X.Y., Li, H.T. | Deposition date: | 2024-07-12 |
|
PDBID: | 9iq0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9iq2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9iq1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9ipy | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-07-12 |
|
PDBID: | 9iqf | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of MsRv1273c/72c from Mycobacterium smegmatis in the ADP-bound IFasym-4 (peptidisc) state | Authors: | Lan, Y., Li, J. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9iqe | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of MsRv1273c/72c from Mycobacterium smegmatis in the ADP-bound IFasym-3 (peptidisc) state | Authors: | Lan, Y., Li, J. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9iqh | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of sulfhydrylase | Authors: | Li, X.J., Chen, L.X., Lin, J.Q. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9iqg | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of MsRv1273c/72c from Mycobacterium smegmatis in the ATP|ADP+Vi-bound Occ (Vi) state | Authors: | Lan, Y., Jing, Y., Li, J. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9iq4 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-12 |
|
PDBID: | 9iq3 | Status: | HPUB -- hold until publication | Title: | AkaM,SnoaL-lile Protein | Authors: | Zhang, B., Ma, X.X., Zhu, A., Ge, H.M. | Deposition date: | 2024-07-12 |
|
PDBID: | 9iq8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9iqa | Status: | HPUB -- hold until publication | Title: | structure of the oleate hydratase V206L-mutant from Staphylococcus aureus | Authors: | Xue, S., Feng, T. | Deposition date: | 2024-07-12 |
|
PDBID: | 9iq5 | Status: | HPUB -- hold until publication | Title: | CatM, SnoaL-like protein | Authors: | Zhang, B., Zhu, A., Ma, X.X., Ge, H.M. | Deposition date: | 2024-07-12 |
|
PDBID: | 9iq7 | Status: | HPUB -- hold until publication | Title: | SacM-homologous of AkaM | Authors: | Zhang, B., Ge, H.M. | Deposition date: | 2024-07-12 |
|