Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:8pro
Status:HPUB -- hold until publication
Title:The structure of nvBagel2 binding the P8W48O184 polyoxometalate
Authors:Vandebroek, L., Voet, A.R.D., Lee, X.Y.
Deposition date:2023-07-12
PDBID:8pru
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Engineered form of T thermophiles AHIR
Authors:Roberts, M., Powell, A., Lewis, C., Sinclair, J.
Deposition date:2023-07-12
PDBID:8tg0
Status:HPUB -- hold until publication
Title:Solution NMR structure of the cold shock domain of the Arabidopsis thaliana glycine-rich protein AtGRP2
Authors:Pougy, K.C., Almeida, F.C.L., Pinheiro, A.S.
Deposition date:2023-07-12
Release date:2025-01-12
PDBID:8k1x
Status:HOLD -- hold until a certain date
Title:Biochemical and structural characterization of a multifunctional cytochrome P450 SpcN in staurosporine biosynthesis
Authors:Xiao, F., Dong, S., Feng, Y., Li, W.
Deposition date:2023-07-11
Release date:2024-10-11
PDBID:8ppx
Status:HPUB -- hold until publication
Title:Influenza A/California/07/2009(H1N1) endonuclease in complex with flavonoid-like compound
Authors:Radilova, K., Brynda, J.
Deposition date:2023-07-10
Release date:2025-01-10
PDBID:8tez
Status:HPUB -- hold until publication
Title:Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH
Authors:Donkor, A.K., Safo, M.K., Musayev, F.N.
Deposition date:2023-07-07
PDBID:8tf1
Status:HPUB -- hold until publication
Title:Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH and Pyridoxal
Authors:Donkor, A.K., Safo, M.K., Musayev, F.N.
Deposition date:2023-07-07
PDBID:8tf6
Status:HPUB -- hold until publication
Title:X-ray Crystal Structure Determination of Dihydromethanopterin Reductase A (DmrA) from Methylobacterium extorquens AM1 by Se-SAD Phasing in a F222 Crystal form at 2.70 Angstroms Resolution
Authors:Axelrod, H.L., Rasche, M., Cascio, D., Arbing, M., Collazo, M.J., Potla, P.S., ?
Deposition date:2023-07-07
Release date:2025-01-08
Sequence:

>Entity 1


(MSE)IDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALT(MSE)GHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
PDBID:8jzp
Status:HOLD -- hold until a certain date
Title:Structure of mouse C5a-human C5aR1-Go complex
Authors:Yadav, M.K., Yadav, R., Maharana, J., Sarma, P., Banerjee, R., Shukla, A.K., Gati, C.
Deposition date:2023-07-06
Release date:2025-01-06
PDBID:8pox
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Crystal Structure of the C19G variant of the membrane-bound [NiFe]-Hydrogenase from Cupriavidus necator in the H2-reduced state at 1.6 A Resolution.
Authors:Kalms, J., Schmidt, A., Scheerer, P.
Deposition date:2023-07-05
PDBID:8poy
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Crystal Structure of the C120G variant of the membrane-bound [NiFe]-Hydrogenase from Cupriavidus necator in the air-oxidized state at 1.93 A Resolution.
Authors:Schmidt, A., Kalms, J., Scheerer, P.
Deposition date:2023-07-05
PDBID:8poz
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Crystal Structure of the C120G variant of the membrane-bound [NiFe]-Hydrogenase from Cupriavidus necator in the H2-reduced state at 1.65 A Resolution.
Authors:Schmidt, A., Kalms, J., Scheerer, P.
Deposition date:2023-07-05
PDBID:8te8
Status:HPUB -- hold until publication
Title:Crystal Structure of Pyridoxal Reductase (PDXI)
Authors:Donkor, A.K., Safo, M.K., Musayev, F.N.
Deposition date:2023-07-05
PDBID:8tbc
Status:HPUB -- hold until publication
Title:Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg
Authors:Abhiraman, G.C., Jude, K.M., Garcia, K.C.
Deposition date:2023-06-28
Release date:2024-12-28
PDBID:8t8t
Status:HPUB -- hold until publication
Title:Crystal structure of TET25 in complex with PyDH2 ligand in P212121 space group
Authors:Lam, G., Yatsunyk, L.A.
Deposition date:2023-06-23
PDBID:8pie
Status:HPUB -- hold until publication
Title:Crystal structure of the human nucleoside diphosphate kinase B domain in complex with the product AT-8500 formed by catalysis of compound AT-9010
Authors:Feracci, M., Chazot, A., Ferron, F., Alvarez, K., Canard, B.
Deposition date:2023-06-21
Release date:2024-12-26
PDBID:8t7r
Status:HOLD -- hold until a certain date
Title:Crystal structure of human leukocyte antigen A*0101 in complex with the Fab of alloreactive antibody E07
Authors:Green, T.J., Killian Jr, J.T., Qiu, S., Macon, K.J., Yang, G., King, R.G., Lund, F.E.
Deposition date:2023-06-21
Release date:2024-12-21
PDBID:8phm
Status:HPUB -- hold until publication
Title:Oxalate-bound cobalt(II) human carbonic anhydrase II
Authors:Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C.
Deposition date:2023-06-20
Release date:2024-12-20
Sequence:

>Entity 1


NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
PDBID:8t68
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:Crystal Structure of the SET Domain of Human Histone-Lysine N-Methyltransferase SUV420H1 in complex with RQ3-111
Authors:Zeng, H., Dong, A., Brown, P.J., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC)
Deposition date:2023-06-15
PDBID:8per
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the Calf domains of Integrin Alpha5 in complex with angiopoietin2 peptide
Authors:Murthy, A.V., Sipila, T.J.O., Ponna, S.K., Leppanen, V.M.L., Saharinen, P.I.
Deposition date:2023-06-14
Release date:2024-12-14
PDBID:8t5v
Status:HPUB -- hold until publication
Title:Influenza PA-N Endonuclease A36V mutant with Baloxavir
Authors:Kohlbrand, A.J., Cohen, S.M.
Deposition date:2023-06-14
PDBID:8jq2
Status:HOLD -- hold until a certain date
Title:Cryo-EM structures of a heme transporter in the heme a biosynthesis pathway of Mycobacteria tuberculosis
Authors:Chen, X.B., Li, J.
Deposition date:2023-06-13
Release date:2024-12-13
PDBID:8jq7
Status:HOLD -- hold until a certain date
Title:Cryo-EM structures of a heme-bound transporter in the heme a biosynthesis pathway of Mycobacteria tuberculosis
Authors:Chen, X.B., Li, J.
Deposition date:2023-06-13
Release date:2024-12-13
PDBID:8jq8
Status:HOLD -- hold until a certain date
Title:Cryo-EM structures of a heme transporter bound to ATP in the heme a biosynthesis pathway of Mycobacteria tuberculosis
Authors:Chen, X.B., Li, J.
Deposition date:2023-06-13
Release date:2024-12-13
PDBID:8t3g
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Hypomethylated yeast 80S bound with cycloheximide, P-site tRNA, and A-site tRNA, messenger RNA from composite map
Authors:Zhao, Y., Li, H.
Deposition date:2023-06-07
Release date:2024-12-11

222624

PDB entries from 2024-07-17

PDB statisticsPDBj update infoContact PDBjnumon