| PDBID: | 9yl6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of as-isolated Fe(III)Fe(III) Streptomyces griseoflavus HrmI | | Authors: | Pope, S.R., Boal, A.K. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9sx9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Vibrio cholerae competence pilus | | Authors: | Maggi, S., Kreida, S., Yang, L., Teipen, A.E., Lynch, D.L., Dalia, A.B., Gumbart, J.C., Jensen, G.J. | | Deposition date: | 2025-10-08 | | Release date: | 2026-10-08 |
|
| PDBID: | 9sx6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of the octamer MraZ in complex with 1 box promoter from Mycoplasma genitalium | | Authors: | Reverter, D., Sanchez-Alba, L., Durand, A. | | Deposition date: | 2025-10-08 | | Release date: | 2026-10-08 |
|
| PDBID: | 9sx4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with HT1.6 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9x2r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of a GRAS protein heterodimer complex | | Authors: | Wan, L.H., Hu, Y.X. | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9ykr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the GLP (EHMT1) SET domain in complex with SAM and TNG917 | | Authors: | Whittington, D.A. | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9yks | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the G9a (EHMT2) SET domain in complex with SAM and TNG917 | | Authors: | Whittington, D.A. | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9swu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NcBBE14 | | Authors: | Bijelic, A., Baldauf, S., Macheroux, P. | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9yk1 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of D132N Bacillus halodurans RNase H1 in complex with RNA/DNA duplex | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-06 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
>Entity 2
UCGACA
>Entity 3
(DA)(DT)(DG)(DT)(DC)(DG)
|
|
| PDBID: | 9yk3 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of D132N Bacillus halodurans RNase H1 in complex with complementary RNA/DNA duplex | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-06 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
>Entity 2
CGACAU
>Entity 3
(DA)(DT)(DG)(DT)(DC)(DG)
|
|
| PDBID: | 9yk5 | | Status: | HPUB -- hold until publication | | Title: | 100K X-ray structure of mixed metal D132N Bacillus halodurans RNase H1 complex with RNA/DNA duplex | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-06 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
>Entity 2
UCGACA
>Entity 3
(DA)(DT)(DG)(DT)(DC)(DG)
|
|
| PDBID: | 9yk6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of anti-HCV human neutralizing antibody K595 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9ykd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of anti-HCV human neutralizing antibody K569 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9yjw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Transferrin Binding Protein A | | Authors: | Dubey, S., Noinaj, N. | | Deposition date: | 2025-10-05 |
|
| PDBID: | 9swc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Hen egg-white lysozyme structure in LCP medium collected via the Round-Chip method | | Authors: | Zabelskii, D., Round, A. | | Deposition date: | 2025-10-05 | | Release date: | 2026-10-05 |
|
| PDBID: | 9sw4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the MvhAGD-HdrABC dimer of M. marburgensis under state 1 substate a (composite structure) | | Authors: | San Segundo-Acosta, P., Murphy, B.J. | | Deposition date: | 2025-10-04 |
|
| PDBID: | 9sw2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the MvhAGD-HdrABC dimer of M. marburgensis under state 2 substate a (composite structure) | | Authors: | San Segundo-Acosta, P., Murphy, B.J. | | Deposition date: | 2025-10-04 |
|
| PDBID: | 9sw1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with A4 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-04 |
|
| PDBID: | 9sw7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human carbonic anhydrase II in complex with 4-ethoxy-3-(1-methyl-7-oxo-3-propyl-6,7-dihydro-1H-pyrazolo[4,3-d]pyrimidin-5-yl)-N-(4-sulfamoylbenzyl)benzenesulfonamide | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2025-10-04 |
|
| PDBID: | 9sw8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human carbonic anhydrase II in complex with 4-(4-((4-ethoxy-3-(1-methyl-7-oxo-3-propyl-6,7-dihydro-1H-pyrazolo[4,3-d]pyrimidin-5-yl)phenyl)sulfonyl)-1,4-diazepan-1-yl)-3-fluorobenzenesulfonamide | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2025-10-04 |
|
| PDBID: | 9x24 | | Status: | HPUB -- hold until publication | | Title: | zearalenone degrading enzyme mutant S102A/L134V/M157V with a-zearalenol | | Authors: | Ouyang, B., Xu, W. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9yjo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C virus envelope glycoprotein E2ecto from genotype 1a bound to neutralizing antibody K601 and HEPC46 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9yj3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PC94-A.27 Fab in complex with P94_v18_c046 Chimera DS-SOSIP trimer and RM20A3 Fab | | Authors: | Phulera, S., Omorodion, O., Ward, A.B., Ozorowski, G. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9yj2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PC94-A.30 Fab in complex with BG505 SOSIP trimer and RM20A3 Fab | | Authors: | Phulera, S., Omorodion, O., Ward, A.B., Ozorowski, G. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9yj0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PC94-A.16 Fab in complex with P94_v18_c046 Chimera DS-SOSIP trimer and RM20A3 Fab | | Authors: | Phulera, S., Omorodion, O., Ward, A.B., Ozorowski, G. | | Deposition date: | 2025-10-03 |
|
