| PDBID: | 9kp4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human CASTOR1 in apo form | | Authors: | Liu, C., Ding, J., Zhang, T. | | Deposition date: | 2024-11-22 | | Release date: | 2026-05-22 |
|
| PDBID: | 9kpb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human CASTOR2 in apo form | | Authors: | Liu, C., Ding, J., Zhang, T. | | Deposition date: | 2024-11-22 | | Release date: | 2026-05-22 |
|
| PDBID: | 9kpg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human CASTOR2-arginine | | Authors: | Liu, C., Ding, J., Zhang, T. | | Deposition date: | 2024-11-22 | | Release date: | 2026-05-22 |
|
| PDBID: | 9hi0 | | Status: | HOLD -- hold until a certain date | | Title: | STRUCTURE OF HUMAN UDP-GALACTOSE 4-EPIMERASE IN COMPLEX WITH COMPOUND WBX04 | | Authors: | Mouilleron, S., Schumann, B., Browne, W., Purkiss, A., Weckwerth, T., Ogrodowicz, R., Prema, R., Kunzelmann, S., Roustan, C. | | Deposition date: | 2024-11-22 | | Release date: | 2025-11-22 |
|
| PDBID: | 9hi1 | | Status: | HOLD -- hold until a certain date | | Title: | STRUCTURE OF HUMAN UDP-GALACTOSE 4-EPIMERASE IN COMPLEX WITH COMPOUND WBX09 | | Authors: | Mouilleron, S., Schumann, B., Browne, W., Purkiss, A., Weckwerth, T., Ogrodowicz, R., Prema, R., Kunzelmann, S., Roustan, C. | | Deposition date: | 2024-11-22 | | Release date: | 2025-11-22 |
|
| PDBID: | 9hi2 | | Status: | HOLD -- hold until a certain date | | Title: | STRUCTURE OF HUMAN UDP-GALACTOSE 4-EPIMERASE IN COMPLEX WITH COVALENT COMPOUND WBC10 | | Authors: | Mouilleron, S., Schumann, B., Browne, W., Purkiss, A., Weckwerth, T., Ogrodowicz, R., Prema, R., Kunzelmann, S., Roustan, C. | | Deposition date: | 2024-11-22 | | Release date: | 2025-11-22 |
|
| PDBID: | 9kos | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of RaTG13 RBD complexed with sheep ACE2 | | Authors: | Lan, J., Wang, C.H. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9kow | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of RaTG13 RBD complexed with cattle ACE2 | | Authors: | Lan, J., Wang, C.H. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hhh | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease C111S of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9hhg | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9hhi | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease without zinc of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9koa | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 3C-like protease double mutant (T21I and E166A) in complex with inhibitor simnotrelvir | | Authors: | Nie, T.Q., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9ko7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of chicken ACE2 | | Authors: | Lan, J., Wang, C.H. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9koc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 3C-like protease double mutant (T21I and E166A) in complex with inhibitor ensitrelvir | | Authors: | Nie, T.Q., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9eeo | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, CTP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ees | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in an expanded state complexed with CP, ATP, GTP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eeq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eeu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eer | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, GTP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eej | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9een | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, CTP, and Mg2+ | | Authors: | Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eed | | Status: | HPUB -- hold until publication | | Title: | The Hanks-type kinase PknS from Xanthomonas citri bound to CHIR-124 | | Authors: | Lima, L.P., Alvarez-Martinez, C.E., Massirer, K.B., Counago, R.M. | | Deposition date: | 2024-11-19 | | Sequence: | >Entity 1
SMSLAATAWQRLEALFHRACQLPAAEREAFARAQAGDDASLRDDLLAMLAVESQATLRVRAPLKQAVAALRAPLPELPAGTRFGAWAIDRLIGAGGMGQVYLGHRADGAYEREVAIKLVAADALDAQGRALFEFECRLLAQMVHPAIAQIHDVGTDAHGQPYLVAEYLRGEPITWWCDEHRLSLHARVLLMLRVGEAVQHAHQKGVIHRDLKPSNVLVSEIDGRPMPGVIDFGIAVDATNPGMTYAHDRGTPGYMSPEQARGAQDVDARSDIYALGAMFYELSCGLAPVAGRDGVPQPPSQRVAAVPADARARICAARATTYQKLHEQLRDGLDAIVLRALEPQPGARYASVSALLDDLHRWLD
|
|
| PDBID: | 9eep | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP and succinate | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eel | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, CTP, UTP, and Mg2+ | | Authors: | Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9hge | | Status: | HPUB -- hold until publication | | Title: | PB1 domain of p62/SQSTM1 | | Authors: | Berkamp, S., Jungbluth, L., Katranidis, A., Mostafavi, S., Sachse, C. | | Deposition date: | 2024-11-19 |
|
