| PDBID: | 8v8t | | Status: | HPUB -- hold until publication | | Title: | Asymmetrical subunit from a Drp1 lattice on PA nanotubes | | Authors: | Rochon, K., Peng, R., Stagg, S.M., Mears, J.A. | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8xbk | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human Liver Fructose-1,6-bisphosphatase Complexed with a Covalent Inhibitor | | Authors: | Cao, H., Zhang, X., Ren, Y., Wan, J. | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8xb7 | | Status: | HOLD -- hold until a certain date | | Title: | HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) bound with 4-hydroxy benzoic acid - Conformation II at 2.6 angstrom resolution | | Authors: | Goswami, A., Raju, R., Kasarla, M. | | Deposition date: | 2023-12-06 | | Release date: | 2024-12-06 |
|
| PDBID: | 8xbj | | Status: | HPUB -- hold until publication | | Title: | The X-ray structure of F46C myoglobin with a covalently linked Ni-complex | | Authors: | Lin, Y.W., Yuan, H. | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8rby | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of the SARS-CoV-2 receptor binding domain in complex with the neutralizing nanobody 1.26 | | Authors: | Casasnovas, J.M., Fernandez, L.A., Silva, K. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8rc3 | | Status: | HPUB -- hold until publication | | Title: | DNA bound type IV-A1 CRISPR effector complex from P. oleovorans | | Authors: | Miksys, A., Cepaite, R., Malinauskaite, L., Pausch, P. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8v8q | | Status: | HPUB -- hold until publication | | Title: | HUMAN LEUKOCYTE ANTIGEN B*07:02 IN COMPLEX WITH MERS-COV EPITOPE N95-103 (A95S mutant) | | Authors: | Oltean, N., Nyovanie, S., Hashem, A., Patskovska, L., Patskovsky, Y., Krogsgaard, M. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8v8r | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Reactive Enamine Deaminase A (RidA) Homolog from an Opportunistic Pathogen, Streptococcus sanguinis. | | Authors: | Thomas, L.M., Rajan, R., Somalinga, V., Benedict, A., Aquino, A. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xb1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of FLT3 in complex with a Pyrazinamide Macrocycle derivative | | Authors: | Guo, M., Chen, Y. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8rbf | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the post-powerstroke actomyosin-5a complex | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of chimeric human carbonic anhydrase IX with 4-chloro-2-(cyclohexylsulfanyl)-N-(2-hydroxyethyl)-5-sulfamoylbenzamide | | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | | Deposition date: | 2023-12-04 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8rbg | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of primed myosin-5a (ADP-Pi state) | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8v7q | | Status: | HPUB -- hold until publication | | Title: | IpaD (122-321) Pi-helix Mutant (delta Q148) Apo Structure | | Authors: | Barker, S.A., Dickenson, N.E., Johnson, S.J. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rar | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of chimeric human carbonic anhydrase IX with N-butyl-4-chloro-2-(cyclohexylsulfanyl)-5-sulfamoylbenzamide | | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | | Deposition date: | 2023-12-01 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8v5u | | Status: | HPUB -- hold until publication | | Title: | Human SIRT3 bound to p53-AMC peptide and Honokiol | | Authors: | Chakrabarti, R., Ghosh, A., Guan, X., Upadhyay, A., Dumpati, R.K., Munshi, S., Roy, S., Chall, S., Rahnamoun, A., Reverdy, C., Errasti, G., Delacroix, T. | | Deposition date: | 2023-12-01 | | Sequence: | >Entity 1
SDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
>Entity 2
QPK(FDL)
|
|
| PDBID: | 8r9v | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the primed actomyosin-5a complex | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5b | | Status: | HPUB -- hold until publication | | Title: | Structure of the oxygen-insensitive NAD(P)H-dependent nitroreductase NfsB_Ec F70A/F108Y in complex with FMN | | Authors: | Sharrock, A.V., Ackerley, D.F., Arcus, V. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v50 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP6 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J., Gras, S. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v51 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP10 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J., Gras, S. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8x96 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of enterovirus A71 A-particle in complex with Fab h1A6.2 | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8v4z | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP7 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8x99 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of coxsackievirus A16 A-particle in complex with Fab h1A6.2 | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8r89 | | Status: | HPUB -- hold until publication | | Title: | Structure of peptide CpRE12 bound to DPC micelle | | Authors: | Kornilov, F., Taldaev, A., Bashkirov, P., Bocharov, E. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8r8b | | Status: | HPUB -- hold until publication | | Title: | Wnt binding to COPalpha and COPBeta2 directs secretion on extracellular vesicles | | Authors: | Gurriaran-Rodriguez, U., Datzkiw, D., Radusky, L.G., Fisher, F., Xiao, F., Ming, H., De Repentigny, Y., Kothary, R., Serrano, L., Rojas, A.L., Hierro, A., Rudnicki, M.A. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v4b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR structure of a synthetic analogue of Ramoplanin A2 | | Authors: | Swarbrick, J.D., Marschall, E.A., Cryle, M.J., Tailhades, J. | | Deposition date: | 2023-11-28 |
|
