Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9d63
Status:PROC -- to be processed
Title:Crystal structure of Human Galectin-3 CRD in complex with Galactose (Galactose soak)
Authors:dos Santos, L.V., Dias, I.P., Mazepa, E., Minella, T.F., Baruffi, M.R., Mestriner, L., Nascimento, A.F.Z., Albuquerque, L.J.C., Mischiatti, K.L., Winnischofer, S.M.B., Amaral, S.S., Silveira, J.L.M., Picheth, G.F.
Deposition date:2024-08-14
PDBID:9d64
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of Human Galectin-3 CRD in complex with Galacturonic acid (Galacturonic acid soak)
Authors:dos Santos, L.V., Dias, I.P., Mazepa, E., Minella, T.F., Baruffi, M.R., Mestriner, L., Nascimento, A.F.Z., Albuquerque, L.J.C., Mischiatti, K.L., Winnischofer, S.M.B., Amaral, S.S., Silveira, J.L.M., Picheth, G.F.
Deposition date:2024-08-14
PDBID:9d50
Status:HPUB -- hold until publication
Title:Structure of PAK1 in complex with compound 24
Authors:Fontano, E., Suto, R.K., Olland, A.M.
Deposition date:2024-08-13
PDBID:9d4i
Status:HOLD -- hold until a certain date
Title:Crystal structure of Ni(II)-bound polysaccharide deacetylase from Bacteroides ovatus
Authors:Dzuong, E., McLaughlin, K.J.
Deposition date:2024-08-12
Release date:2025-08-12
PDBID:9d4n
Status:HPUB -- hold until publication
Title:The cryo-EM structure of the yeast Dmc1 filament bound to ssDNA in the presence of ATP
Authors:Shin, Y., Greene, E.C.
Deposition date:2024-08-12
PDBID:9gfk
Status:HPUB -- hold until publication
Title:human MDM2 complex with stapled foldamer
Authors:Neuville, M., Bourgeais, M., Buratto, J., Saragaglia, C., Bo, L., Mauran, L., Varajao, L., Goudreau, S.R., Kauffmann, B., Thinon, E., Pasco, M., Khatib, A.M.
Deposition date:2024-08-09
PDBID:9gfj
Status:HPUB -- hold until publication
Title:Crystal structure of ASO binding Fab fragment with ASO143
Authors:Hsia, H.-E., Zanini, C., Simonneau, C., Fraidling, J., Kraft, T., Mayer, K., Sommer, A., Indlekofer, A., Wirht, T., Benz, J., Georges, G., Langer, L.M., Gassner, C., Larraillet, V., Manso, M., Ravn, J., Hofer, K., Emrich, T., Niewoehner, J., Schumacher, F., Brinkmann, U.
Deposition date:2024-08-09
PDBID:9gfl
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ASO binding Fab fragment
Authors:Hsia, H.-E., Zanini, C., Simonneau, C., Fraidling, J., Kraft, T., Mayer, K., Sommer, A., Indlekofer, A., Wirth, T., Benz, J., Georges, G., Langer, L.M., Gassner, C., Larraillet, V., Manso, M., Ravn, J., Hofer, K., Emrich, T., Niewoehner, J., Schumacher, F., Brinkmann, U.
Deposition date:2024-08-09
PDBID:9gfd
Status:HPUB -- hold until publication
Title:Crystal structure of ASO binding Fab fragment with ASO139
Authors:Hsia, H.-E., Zanini, C., Simonneau, C., Fraidling, J., Kraft, T., Mayer, K., Sommer, A., Indlekofer, A., Wirth, T., Benz, J., Geroges, G., Langer, M.L., Gassner, C., Larraillet, V., Manso, M., Ravn, J., Hofer, K., Emrich, T., Niewoehner, J., Schumacher, F., Brinkmann, U.
Deposition date:2024-08-09
PDBID:9d3f
Status:HPUB -- hold until publication
Title:Water and chloride as allosteric inhibitors in WNK kinase osmosensing
Authors:Akella, R., Goldsmith, E.J.
Deposition date:2024-08-09
Sequence:

>Entity 1


QEERNQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQERKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEET
PDBID:9gef
Status:AUTH -- processed, waiting for author review and approval
Title:Experimental localization of metal-binding sites reveals the role of metal ions in the delafloxacin-stabilized Streptococcus pneumoniae topoisomerase IV DNA cleavage complex
Authors:Wang, B., Najmudin, S., Pan, X.-S., Mykhaylyk, V., Orr, C., Wagner, A., Govada, L., Chayen, N.E., Fisher, L.M., Sanderson, M.R.
Deposition date:2024-08-08
Release date:2025-08-08
PDBID:9d2k
Status:HPUB -- hold until publication
Title:SARS-CoV-2 Papain-like Protease (PLpro) complex with covalent inhibitor Jun13567
Authors:Ansari, A., Tan, B., Ruiz, F.X., Arnold, E., Wang, J.
Deposition date:2024-08-08
PDBID:9d2d
Status:HPUB -- hold until publication
Title:E. coli cysteine desulfurase SufS R359A
Authors:Dunkle, J.A., Frantom, P.A.
Deposition date:2024-08-08
Sequence:

>Entity 1


MIFSVDKVRADFPVLSREVNGLPLAYLDSAASAQKPSQVIDAEAEFYRHGYAAVHRGIHTLSAQATEKMENVRKRASLFINARSAEELVFVRGTTEGINLVANSWGNSNVRAGDNIIISQMEHHANIVPWQMLCARVGAELRVIPLNPDGTLQLETLPTLFDEKTRLLAITHVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQALDCDFYVFSGHKLYGPTGIGILYVKEALLQEMPPWEGGGSMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLNNIAEYEQNLMHYALSQLESVPDLTLYGPQNRLGVIAFNLGKHHAYDVGSFLDNYGIAVATGHHCAMPLMAYYNVPAMCRASLAMYNTHEEVDRLVTGLQRIHRLLG
PDBID:9ges
Status:HPUB -- hold until publication
Title:Crystal structure of HEI10
Authors:Milburn, A.E., Espejo-Serrano, C., Dunce, J.M., Davies, O.R.
Deposition date:2024-08-07
PDBID:9gek
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of the FAST1-FAST2-RAP module from human FASTKD4 by carrier-driven crystallisation with maltose binding protein from E. coli.
Authors:Hothorn, M., Lau, K., Yang, X.
Deposition date:2024-08-07
PDBID:9j32
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of aminotransferase-like protein from Variovorax paradoxus mutant N174K
Authors:Ilyasov, I.O., Minyaev, M.E., Rakitina, T.V., Bakunova, A.K., Matyuta, I.O., Popov, V.O., Bezsudnova, E.Y., Boyko, K.M.
Deposition date:2024-08-07
PDBID:9d0g
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with O-cresomycin, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.50A resolution
Authors:Aleksandrova, E.V., Wu, K.J.Y., Robinson, P.J., Benedetto, A.E., Yu, M., Tresco, B.I.C., See, D.N.Y., Jiang, T., Ramkissoon, A., Dunand, C.F., Svetlov, M.S., Lee, J., Myers, A.G., Polikanov, Y.S.
Deposition date:2024-08-07
PDBID:9d0h
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with C-cresomycin, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.50A resolution
Authors:Aleksandrova, E.V., Wu, K.J.Y., Robinson, P.J., Benedetto, A.E., Yu, M., Tresco, B.I.C., See, D.N.Y., Jiang, T., Ramkissoon, A., Dunand, C.F., Svetlov, M.S., Lee, J., Myers, A.G., Polikanov, Y.S.
Deposition date:2024-08-07
PDBID:9d0i
Status:HPUB -- hold until publication
Title:Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Se-cresomycin, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.45A resolution
Authors:Aleksandrova, E.V., Wu, K.J.Y., Robinson, P.J., Benedetto, A.E., Yu, M., Tresco, B.I.C., See, D.N.Y., Jiang, T., Ramkissoon, A., Dunand, C.F., Svetlov, M.S., Lee, J., Myers, A.G., Polikanov, Y.S.
Deposition date:2024-08-07
PDBID:9d0j
Status:HPUB -- hold until publication
Title:Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with BT-33, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.50A resolution
Authors:Aleksandrova, E.V., Tresco, B.I.C., Wu, K.J.Y., Ramkissoon, A., Purdy, M., See, D.N.Y., Liu, R.Y., Myers, A.G., Polikanov, Y.S.
Deposition date:2024-08-07
PDBID:9gdw
Status:HPUB -- hold until publication
Title:RNA binding domain of Turnip crinkle virus p38, p38R
Authors:Weininger, U., Golbik, R., Thondorf, I., Behrens, S.E.
Deposition date:2024-08-06
PDBID:9d02
Status:HPUB -- hold until publication
Title:Co-crystal structure of circularly permuted human taspase-1 bound to ligand SMDC1014883 (2R)-4-(ethenesulfonyl)-1-{[3-fluoro-4-(trifluoromethoxy)phenyl]methyl}-2-[(prop-2-yn-1-yloxy)methyl]piperazine
Authors:Delker, S.L., Edwards, T.E., Abendroth, J.
Deposition date:2024-08-06
PDBID:9d03
Status:HPUB -- hold until publication
Title:Co-crystal structure of circularly permuted human taspase-1 bound to ligand SMDC1014689 1-(ethenesulfonyl)-4-{[3-fluoro-4-(trifluoromethoxy)phenyl]methyl}piperazine
Authors:Delker, S.L., Edwards, T.E., Abendroth, J.
Deposition date:2024-08-06
PDBID:9d04
Status:HPUB -- hold until publication
Title:CO-CRYSTAL STRUCTURE OF CIRCULARLY PERMUTED HUMAN TASPASE-1 BOUND TO LIGAND SMDC994967 1-(ETHENESULFONYL)-4-{[4- (TRIFLUOROMETHOXY)PHENYL]METHYL}PIPERAZINE
Authors:Delker, S.L., Edwards, T.E., Abendroth, J.
Deposition date:2024-08-06
PDBID:9d06
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of IgG1 FC M252R at pH 5.6
Authors:Reddem, E.R., Shapiro, L.
Deposition date:2024-08-06

225946

PDB entries from 2024-10-09

PDB statisticsPDBj update infoContact PDBjnumon