PDBID: | 9d63 | Status: | PROC -- to be processed | Title: | Crystal structure of Human Galectin-3 CRD in complex with Galactose (Galactose soak) | Authors: | dos Santos, L.V., Dias, I.P., Mazepa, E., Minella, T.F., Baruffi, M.R., Mestriner, L., Nascimento, A.F.Z., Albuquerque, L.J.C., Mischiatti, K.L., Winnischofer, S.M.B., Amaral, S.S., Silveira, J.L.M., Picheth, G.F. | Deposition date: | 2024-08-14 |
|
PDBID: | 9d64 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of Human Galectin-3 CRD in complex with Galacturonic acid (Galacturonic acid soak) | Authors: | dos Santos, L.V., Dias, I.P., Mazepa, E., Minella, T.F., Baruffi, M.R., Mestriner, L., Nascimento, A.F.Z., Albuquerque, L.J.C., Mischiatti, K.L., Winnischofer, S.M.B., Amaral, S.S., Silveira, J.L.M., Picheth, G.F. | Deposition date: | 2024-08-14 |
|
PDBID: | 9d50 | Status: | HPUB -- hold until publication | Title: | Structure of PAK1 in complex with compound 24 | Authors: | Fontano, E., Suto, R.K., Olland, A.M. | Deposition date: | 2024-08-13 |
|
PDBID: | 9d4i | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of Ni(II)-bound polysaccharide deacetylase from Bacteroides ovatus | Authors: | Dzuong, E., McLaughlin, K.J. | Deposition date: | 2024-08-12 | Release date: | 2025-08-12 |
|
PDBID: | 9d4n | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of the yeast Dmc1 filament bound to ssDNA in the presence of ATP | Authors: | Shin, Y., Greene, E.C. | Deposition date: | 2024-08-12 |
|
PDBID: | 9gfk | Status: | HPUB -- hold until publication | Title: | human MDM2 complex with stapled foldamer | Authors: | Neuville, M., Bourgeais, M., Buratto, J., Saragaglia, C., Bo, L., Mauran, L., Varajao, L., Goudreau, S.R., Kauffmann, B., Thinon, E., Pasco, M., Khatib, A.M. | Deposition date: | 2024-08-09 |
|
PDBID: | 9gfj | Status: | HPUB -- hold until publication | Title: | Crystal structure of ASO binding Fab fragment with ASO143 | Authors: | Hsia, H.-E., Zanini, C., Simonneau, C., Fraidling, J., Kraft, T., Mayer, K., Sommer, A., Indlekofer, A., Wirht, T., Benz, J., Georges, G., Langer, L.M., Gassner, C., Larraillet, V., Manso, M., Ravn, J., Hofer, K., Emrich, T., Niewoehner, J., Schumacher, F., Brinkmann, U. | Deposition date: | 2024-08-09 |
|
PDBID: | 9gfl | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ASO binding Fab fragment | Authors: | Hsia, H.-E., Zanini, C., Simonneau, C., Fraidling, J., Kraft, T., Mayer, K., Sommer, A., Indlekofer, A., Wirth, T., Benz, J., Georges, G., Langer, L.M., Gassner, C., Larraillet, V., Manso, M., Ravn, J., Hofer, K., Emrich, T., Niewoehner, J., Schumacher, F., Brinkmann, U. | Deposition date: | 2024-08-09 |
|
PDBID: | 9gfd | Status: | HPUB -- hold until publication | Title: | Crystal structure of ASO binding Fab fragment with ASO139 | Authors: | Hsia, H.-E., Zanini, C., Simonneau, C., Fraidling, J., Kraft, T., Mayer, K., Sommer, A., Indlekofer, A., Wirth, T., Benz, J., Geroges, G., Langer, M.L., Gassner, C., Larraillet, V., Manso, M., Ravn, J., Hofer, K., Emrich, T., Niewoehner, J., Schumacher, F., Brinkmann, U. | Deposition date: | 2024-08-09 |
|
PDBID: | 9d3f | Status: | HPUB -- hold until publication | Title: | Water and chloride as allosteric inhibitors in WNK kinase osmosensing | Authors: | Akella, R., Goldsmith, E.J. | Deposition date: | 2024-08-09 | Sequence: | >Entity 1 QEERNQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQERKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEET
|
|
PDBID: | 9gef | Status: | AUTH -- processed, waiting for author review and approval | Title: | Experimental localization of metal-binding sites reveals the role of metal ions in the delafloxacin-stabilized Streptococcus pneumoniae topoisomerase IV DNA cleavage complex | Authors: | Wang, B., Najmudin, S., Pan, X.-S., Mykhaylyk, V., Orr, C., Wagner, A., Govada, L., Chayen, N.E., Fisher, L.M., Sanderson, M.R. | Deposition date: | 2024-08-08 | Release date: | 2025-08-08 |
|
PDBID: | 9d2k | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 Papain-like Protease (PLpro) complex with covalent inhibitor Jun13567 | Authors: | Ansari, A., Tan, B., Ruiz, F.X., Arnold, E., Wang, J. | Deposition date: | 2024-08-08 |
|
PDBID: | 9d2d | Status: | HPUB -- hold until publication | Title: | E. coli cysteine desulfurase SufS R359A | Authors: | Dunkle, J.A., Frantom, P.A. | Deposition date: | 2024-08-08 | Sequence: | >Entity 1 MIFSVDKVRADFPVLSREVNGLPLAYLDSAASAQKPSQVIDAEAEFYRHGYAAVHRGIHTLSAQATEKMENVRKRASLFINARSAEELVFVRGTTEGINLVANSWGNSNVRAGDNIIISQMEHHANIVPWQMLCARVGAELRVIPLNPDGTLQLETLPTLFDEKTRLLAITHVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQALDCDFYVFSGHKLYGPTGIGILYVKEALLQEMPPWEGGGSMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLNNIAEYEQNLMHYALSQLESVPDLTLYGPQNRLGVIAFNLGKHHAYDVGSFLDNYGIAVATGHHCAMPLMAYYNVPAMCRASLAMYNTHEEVDRLVTGLQRIHRLLG
|
|
PDBID: | 9ges | Status: | HPUB -- hold until publication | Title: | Crystal structure of HEI10 | Authors: | Milburn, A.E., Espejo-Serrano, C., Dunce, J.M., Davies, O.R. | Deposition date: | 2024-08-07 |
|
PDBID: | 9gek | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the FAST1-FAST2-RAP module from human FASTKD4 by carrier-driven crystallisation with maltose binding protein from E. coli. | Authors: | Hothorn, M., Lau, K., Yang, X. | Deposition date: | 2024-08-07 |
|
PDBID: | 9j32 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of aminotransferase-like protein from Variovorax paradoxus mutant N174K | Authors: | Ilyasov, I.O., Minyaev, M.E., Rakitina, T.V., Bakunova, A.K., Matyuta, I.O., Popov, V.O., Bezsudnova, E.Y., Boyko, K.M. | Deposition date: | 2024-08-07 |
|
PDBID: | 9d0g | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with O-cresomycin, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.50A resolution | Authors: | Aleksandrova, E.V., Wu, K.J.Y., Robinson, P.J., Benedetto, A.E., Yu, M., Tresco, B.I.C., See, D.N.Y., Jiang, T., Ramkissoon, A., Dunand, C.F., Svetlov, M.S., Lee, J., Myers, A.G., Polikanov, Y.S. | Deposition date: | 2024-08-07 |
|
PDBID: | 9d0h | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with C-cresomycin, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.50A resolution | Authors: | Aleksandrova, E.V., Wu, K.J.Y., Robinson, P.J., Benedetto, A.E., Yu, M., Tresco, B.I.C., See, D.N.Y., Jiang, T., Ramkissoon, A., Dunand, C.F., Svetlov, M.S., Lee, J., Myers, A.G., Polikanov, Y.S. | Deposition date: | 2024-08-07 |
|
PDBID: | 9d0i | Status: | HPUB -- hold until publication | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Se-cresomycin, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.45A resolution | Authors: | Aleksandrova, E.V., Wu, K.J.Y., Robinson, P.J., Benedetto, A.E., Yu, M., Tresco, B.I.C., See, D.N.Y., Jiang, T., Ramkissoon, A., Dunand, C.F., Svetlov, M.S., Lee, J., Myers, A.G., Polikanov, Y.S. | Deposition date: | 2024-08-07 |
|
PDBID: | 9d0j | Status: | HPUB -- hold until publication | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with BT-33, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.50A resolution | Authors: | Aleksandrova, E.V., Tresco, B.I.C., Wu, K.J.Y., Ramkissoon, A., Purdy, M., See, D.N.Y., Liu, R.Y., Myers, A.G., Polikanov, Y.S. | Deposition date: | 2024-08-07 |
|
PDBID: | 9gdw | Status: | HPUB -- hold until publication | Title: | RNA binding domain of Turnip crinkle virus p38, p38R | Authors: | Weininger, U., Golbik, R., Thondorf, I., Behrens, S.E. | Deposition date: | 2024-08-06 |
|
PDBID: | 9d02 | Status: | HPUB -- hold until publication | Title: | Co-crystal structure of circularly permuted human taspase-1 bound to ligand SMDC1014883 (2R)-4-(ethenesulfonyl)-1-{[3-fluoro-4-(trifluoromethoxy)phenyl]methyl}-2-[(prop-2-yn-1-yloxy)methyl]piperazine | Authors: | Delker, S.L., Edwards, T.E., Abendroth, J. | Deposition date: | 2024-08-06 |
|
PDBID: | 9d03 | Status: | HPUB -- hold until publication | Title: | Co-crystal structure of circularly permuted human taspase-1 bound to ligand SMDC1014689 1-(ethenesulfonyl)-4-{[3-fluoro-4-(trifluoromethoxy)phenyl]methyl}piperazine | Authors: | Delker, S.L., Edwards, T.E., Abendroth, J. | Deposition date: | 2024-08-06 |
|
PDBID: | 9d04 | Status: | HPUB -- hold until publication | Title: | CO-CRYSTAL STRUCTURE OF CIRCULARLY PERMUTED HUMAN TASPASE-1 BOUND TO LIGAND SMDC994967 1-(ETHENESULFONYL)-4-{[4- (TRIFLUOROMETHOXY)PHENYL]METHYL}PIPERAZINE | Authors: | Delker, S.L., Edwards, T.E., Abendroth, J. | Deposition date: | 2024-08-06 |
|
PDBID: | 9d06 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of IgG1 FC M252R at pH 5.6 | Authors: | Reddem, E.R., Shapiro, L. | Deposition date: | 2024-08-06 |
|