| PDBID: | 9sn8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of anthocyanin-related glutathione transferase from bilberry | | Authors: | Didierjean, C., Favier, F., Mathiot, S. | | Deposition date: | 2025-09-10 | | Sequence: | >Entity 1
MVVKVYGSIRAACPQRVMVCLLEMGVDFELIPVDLESGEHKKPEFLLRQPFGQVPAIEDGDFRLFESRAIIRYYAAKYADYGPNLLGTTLEERALVDQWLEVEAHNFNDLVYNLVLQLVILPRMGERSDLALVSTCENKLEKVLDIYEQRLSKSNYLAGESFTLADLSHLPAIRYLMDEAGLGHMVRNRKNVNSWWMDISSRPAWKKIMKLMD
|
|
| PDBID: | 9sn7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of anthocyanin-related glutathione transferase from poplar in complex with quercetin | | Authors: | Didierjean, C., Favier, F., Mathiot, S. | | Deposition date: | 2025-09-10 | | Sequence: | >Entity 1
VVKVYGPAMAVCPQRVMACLLEKGVEFDLVHVDLDSGEQKLPEFLLKQPFGQVPVVEDGDFKLFESRAIIRYYAAKYEDRGPNLLGNTLEEKALVDQWLEIEAHNFNDLVFNIVFQVVILPRIGQQGDSELVRTYEEKLEKVLDVYEQRLSKSKYLAGDSFTLADLSHLPATRYLVNEAGLGHLVKDRKKLNAWWEDISSRPAWKKLINLAGF
|
|
| PDBID: | 9y79 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC^walked) containing mRNA with a 39 nt long spacer, NusG, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Shandilya, S., Wang, C., Molodtsov, V., Ebright, R.H. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9y6t | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis pyruvate dehydrogenase complex E2p core subunit DlaT in a hexamer state | | Authors: | Hsu, H.C., Li, H. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9y72 | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis pyruvate dehydrogenase complex E2p core subunit DlaT in a two-hexamer state | | Authors: | Hsu, H.C., Li, H. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9y6o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of fimbriae-like lipoprotein by Cryo Electron Microscopy | | Authors: | Hanssen, E., Gorasia, D.G., Reynolds, E.C. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9y74 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [22L-7B C|A] 22 bp L-DNA tensegrity triangle that propagates via blunt-end stacking with C stacking on A at the interface | | Authors: | Horvath, A., Woloszyn, K., Vecchioni, S., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9y76 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the human DCAF1 WDR domain in complex with OICR-40120 | | Authors: | kimani, S., Dong, A., Li, Y., Seitova, A., Mamai, A., Al-awar, R., Ackloo, S., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9y68 | | Status: | HPUB -- hold until publication | | Title: | Full length LRRK2 (G2019S) after symmetry expansion | | Authors: | Villagran Suarez, A.C., Bodrug, T. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9y67 | | Status: | HPUB -- hold until publication | | Title: | Full length LRRK2 after symmetry expansion | | Authors: | Villagran Suarez, A.C., Bodrug, T. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9y65 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Plasmodium falciparum M1 aminopeptidase (PfA-M1) bound to inhibitor 3k (MIPS3415) | | Authors: | Mansouri, M., McGowan, S., Webb, C.T. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9wpb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human transthyretin (TTR) with pryazole-based stabilizer | | Authors: | Choe, J., Choi, S., Shin, H.-C. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9wp4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of phosphate binding protein from Synechocystis sp. PCC 6803 | | Authors: | Wang, C.Y., Lu, Y.P., Ma, H.L. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9wp7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of phosphate binding protein(SphX) from Synechocystis sp. PCC 6803 | | Authors: | Wang, C.Y., Lu, Y.P., Ma, H.L. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9wp6 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Zea mays GLN1 | | Authors: | Wu, X.X., Cheng, Y.Q., Zhang, Y., Huang, Y.C. | | Deposition date: | 2025-09-08 |
|
| PDBID: | 9wox | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | rystal Structure of the MLH1 Protein Bound to the FAN1 Peptide (124-131) | | Authors: | Chen, Y.C., Liu, Y.L., Shang, X.C. | | Deposition date: | 2025-09-07 |
|
| PDBID: | 9woy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | rystal Structure of the MLH1 Protein Bound to the FAN1 Peptide (145-163) | | Authors: | Chen, Y.C., Liu, Y.L., Shang, X.C. | | Deposition date: | 2025-09-07 |
|
| PDBID: | 9wof | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Y393A/R227L FMNH2-dependent monooxygenase in complex with pentane | | Authors: | Lee, C., Kim, D., Ka, S., Park, S., Phan, H.T.L., Oh, J. | | Deposition date: | 2025-09-06 |
|
| PDBID: | 9woe | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Y393A/R227H FMNH2-dependent monooxygenase | | Authors: | Lee, C., Kim, D., Ka, S., Park, S., Phan, H.T.L., Oh, J. | | Deposition date: | 2025-09-06 |
|
| PDBID: | 9wod | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type FMNH2-dependent monooxygenase in complex with FMN and isopropanol | | Authors: | Lee, C., Kim, D., Ka, S., Park, S., Phan, H.T.L., Oh, J. | | Deposition date: | 2025-09-06 |
|
| PDBID: | 9y5p | | Status: | PROC -- to be processed | | Title: | Structure of DNMT3A PWWP domain in complex with histone H3.3 tri-methylated on K36 (30-48) | | Authors: | Samuel C-D-T, V., Shahir M, M., Sabina, S., Alejandro, S., Ibrahim, A., Cassandra J, W., Ayala, M., Omar H, B., Rajesh, A., Giovanni L, B., Jack F, G., Nada, J., Carol C L, C., Elizabeth J, B., Anne-Claude, G., Eric I, C. | | Deposition date: | 2025-09-05 |
|
| PDBID: | 9y5y | | Status: | HPUB -- hold until publication | | Title: | Structure of the Omicron Spike RBD bound by the monobody s19382 (local refinement from dimerized Spike protein ECDs) | | Authors: | Noland, C.L., Perez, C.P., Huang, P. | | Deposition date: | 2025-09-05 |
|
| PDBID: | 9sm9 | | Status: | HPUB -- hold until publication | | Title: | Acoustofluidic Serial Crystallography - On, same number of indexed crystals as Off | | Authors: | Keloth, A., Kellermann, K.H., Henkel, A., Middendorf, P., Chapman, H.C. | | Deposition date: | 2025-09-05 |
|
| PDBID: | 9slr | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the conotoxin CTX14 | | Authors: | Hackney, C.M., Koch, T.L., Ryding, N.L., Rogalski, A., Watkins, M., Olivera, B., Safavi-Memami, H., Teilum, K., Ellgaard, L. | | Deposition date: | 2025-09-05 |
|
| PDBID: | 9y5m | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | LONP1 C3-state | | Authors: | Mindrebo, J.T., Lander, G.C. | | Deposition date: | 2025-09-04 |
|
