| PDBID: | 8qr7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qr8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qr9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qra | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qrb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qrc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qr2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qr3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qr4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qql | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the human inward-rectifier potassium 2.1 channel (Kir2.1) - R312H mutant | | Authors: | Fernandes, C.A.H., Zuniga, D., Venien-Bryan, C. | | Deposition date: | 2023-10-05 |
|
| PDBID: | 8qn8 | | Status: | HPUB -- hold until publication | | Title: | Mycobacterium smegmatis RNA polymerase in complex with HelD, SigA and RbpA in State II | | Authors: | Koval, T., Krasny, L., Dohnalek, J., Kouba, T. | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8qmu | | Status: | HPUB -- hold until publication | | Title: | The complex of Glycogen Phosphorylase with (-)-Epigallocatechin-3-gallate (EGCG). | | Authors: | Alexopoulos, S., Papakostopoulou, S., Koulas, M.S., Leonidas, D.D., Skamnaki, V. | | Deposition date: | 2023-09-25 | | Release date: | 2024-09-25 |
|
| PDBID: | 8ubv | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of dimeric FBXL17-BACH1BTB E3 ubiquitin ligase complex | | Authors: | Shi, H., Cao, S., Zheng, N. | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8ubt | | Status: | HPUB -- hold until publication | | Title: | Structure of SCF-FBXL17-BACH1BTB E3 ligase complex | | Authors: | Shi, H., Cao, S. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8uaw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of Brucella Abortus Lumazine Synthase (BLS) Engineered with Shiga Toxin II subunit B (Stx2B) | | Authors: | Cristofalo, A.E., Sharma, A., Cerutti, M.L., Sharma, K., Zylberman, V., Goldbaum, F.A., Borgnia, M.J., Otero, L.H. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8uah | | Status: | HPUB -- hold until publication | | Title: | Structure of BACH1 BTB domain-bound FBXL17 ubiquitin ligase | | Authors: | Shi, H., Cao, S., Zheng, N. | | Deposition date: | 2023-09-21 |
|
| PDBID: | 8qj2 | | Status: | HPUB -- hold until publication | | Title: | Structure of active state MC4R in complex with a potent ligand mimicking nanobody | | Authors: | Busch, A., Jaakola, V.-P., Masiulis, S. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qht | | Status: | HPUB -- hold until publication | | Title: | Leishmania braziliensis PRMT1-PRMT3 heterotetrameric complex in unliganded form. | | Authors: | Levdikov, V., Nay, E., Walrad, P., Plevin, J.M. | | Deposition date: | 2023-09-10 | | Sequence: | >Entity 1
DYYFDSYSHYGIHMEMLKDYHRTTTYRDAIWRNAYMFKDKVVLDVGCGTGILSMFAARAGARKVIGIDCSNVAVQARQIVQDNGFSDIITIIQGKVEELDLDEKVDIIISEWMGYFLLYESMLNTVLYARDRWGASDVKILPSSANMYACGITDPQYVEQKFNIWNSVNGLDFSYFKRLSYIEPLIDTVNPEQIITDIVPFFSFDINRVTEAELSFTSTFTLEAKQGDFVHAISVHFDTPFYAGHDPVVLNTSPMVPPTHWRQTVLYMFHPLIMKRGEKANFTMKCAPNPGNPRDLDISLHIDFDGELQACHYDQDFRLR
>Entity 2
SAARISSNISTIHDHQRLRAYEVIFRNVRGKTLLHLGCGMGLYSMLAARGMAKMVIGIDSSAIVDAARVVAEQNGLKNIQFIRGRLCEALHQLPSDMKFDYVLCEWMGPLLLNERVLTDALYARDHLLTESGALCPNRASLHVVAVSDYAFRLDTEDFWSNVYGFQMEPMKELVRQEVEMCAIPGSNIVSAPCLAHTIHMDTLEGLTAEETATYEAQANQAAAIRDNEEENPVEHCWVPAAVAQKGYEAAFTLSIARSATVHYLTFYLDAAFTSKTNPGANFVLAVRPGGQNNWTEVSVGLREPLPVNAGEKIQGTVRVYTPAEKGGKVTVVEVTAKTAGQVAAIETFGTYYYQSY
|
|
| PDBID: | 8qco | | Status: | HPUB -- hold until publication | | Title: | E.coli IspE in complex with a ligand (3) | | Authors: | Hamid, R. | | Deposition date: | 2023-08-28 |
|
| PDBID: | 8qcn | | Status: | HPUB -- hold until publication | | Title: | E.coli IspE in complex with a ligand (2) | | Authors: | Hamid, R. | | Deposition date: | 2023-08-27 |
|
| PDBID: | 8qcc | | Status: | HPUB -- hold until publication | | Title: | E.coli IspE in complex with a ligand (1) | | Authors: | Hamid, R. | | Deposition date: | 2023-08-25 |
|
| PDBID: | 8ty3 | | Status: | HPUB -- hold until publication | | Title: | MI-31 ligand bound to SARS-CoV-2 Mpro | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2023-08-24 |
|
| PDBID: | 8twh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of (GGGTT)3GGG G-quadruplex in complex with small molecule ligand RHPS4 | | Authors: | Yatsunyk, L.A., Martin, K.N., Lam, G. | | Deposition date: | 2023-08-21 |
|
| PDBID: | 8q12 | | Status: | HPUB -- hold until publication | | Title: | Endothiapepsin in complex with ligand (3R,5R)-5-(3-(2-aminophenyl)-1,2,4-oxadiazol-5-yl)-3-(2-((methyl(prop-2-yn-1-yl)amino)methyl)thiazol-4-yl)pyrrolidin-3-ol (CBWS-SE-146.2) | | Authors: | Mueller, J.M., Eckelt, S., Klebe, G., Glinca, S. | | Deposition date: | 2023-07-29 |
|
| PDBID: | 8t8t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TET25 in complex with PyDH2 ligand in P212121 space group | | Authors: | Lam, G., Yatsunyk, L.A. | | Deposition date: | 2023-06-23 |
|
