Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9hhh
Status:HPUB -- hold until publication
Title:A rare open conformation for Ubl2 domain of papain-like protease C111S of SARS-CoV2
Authors:Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E.
Deposition date:2024-11-21
Sequence:

>Entity 1


EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
PDBID:9hhg
Status:HPUB -- hold until publication
Title:A rare open conformation for Ubl2 domain of papain-like protease of SARS-CoV2
Authors:Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E.
Deposition date:2024-11-21
Sequence:

>Entity 1


EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
PDBID:9hhi
Status:HPUB -- hold until publication
Title:A rare open conformation for Ubl2 domain of papain-like protease without zinc of SARS-CoV2
Authors:Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E.
Deposition date:2024-11-21
Sequence:

>Entity 1


EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
PDBID:9koa
Status:HPUB -- hold until publication
Title:Crystal structure of SARS-CoV-2 3C-like protease double mutant (T21I and E166A) in complex with inhibitor simnotrelvir
Authors:Nie, T.Q., Su, H.X., Li, M.J., Xu, Y.C.
Deposition date:2024-11-20
PDBID:9ko7
Status:HPUB -- hold until publication
Title:Crystal structure of chicken ACE2
Authors:Lan, J., Wang, C.H.
Deposition date:2024-11-20
PDBID:9koc
Status:HPUB -- hold until publication
Title:Crystal structure of SARS-CoV-2 3C-like protease double mutant (T21I and E166A) in complex with inhibitor ensitrelvir
Authors:Nie, T.Q., Su, H.X., Li, M.J., Xu, Y.C.
Deposition date:2024-11-20
PDBID:9hgp
Status:HPUB -- hold until publication
Title:Human Carbonic Anhydrase II in complex with a synthetic aromatic oligoamide foldamer
Authors:Sigl, J.C., Wang, L., Huc, I.
Deposition date:2024-11-20
PDBID:9eeo
Status:HPUB -- hold until publication
Title:Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, CTP, and Mg2+
Authors:Patterson, M.G., Miller, R.C., Ando, N.
Deposition date:2024-11-19
PDBID:9ees
Status:HPUB -- hold until publication
Title:Cryo-EM model of E. coli aspartate transcarbamoylase in an expanded state complexed with CP, ATP, GTP, and Mg2+
Authors:Patterson, M.G., Miller, R.C., Ando, N.
Deposition date:2024-11-19
PDBID:9eeq
Status:HPUB -- hold until publication
Title:Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, and Mg2+
Authors:Patterson, M.G., Miller, R.C., Ando, N.
Deposition date:2024-11-19
PDBID:9eeu
Status:HPUB -- hold until publication
Title:Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, ATP, and Mg2+
Authors:Patterson, M.G., Miller, R.C., Ando, N.
Deposition date:2024-11-19
PDBID:9eer
Status:HPUB -- hold until publication
Title:Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, GTP, and Mg2+
Authors:Patterson, M.G., Miller, R.C., Ando, N.
Deposition date:2024-11-19
PDBID:9eej
Status:HPUB -- hold until publication
Title:Crystal structure of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, and Mg2+
Authors:Patterson, M.G., Miller, R.C., Ando, N.
Deposition date:2024-11-19
PDBID:9een
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, CTP, and Mg2+
Authors:Miller, R.C., Ando, N.
Deposition date:2024-11-19
PDBID:9eed
Status:HPUB -- hold until publication
Title:The Hanks-type kinase PknS from Xanthomonas citri bound to CHIR-124
Authors:Lima, L.P., Alvarez-Martinez, C.E., Massirer, K.B., Counago, R.M.
Deposition date:2024-11-19
Sequence:

>Entity 1


SMSLAATAWQRLEALFHRACQLPAAEREAFARAQAGDDASLRDDLLAMLAVESQATLRVRAPLKQAVAALRAPLPELPAGTRFGAWAIDRLIGAGGMGQVYLGHRADGAYEREVAIKLVAADALDAQGRALFEFECRLLAQMVHPAIAQIHDVGTDAHGQPYLVAEYLRGEPITWWCDEHRLSLHARVLLMLRVGEAVQHAHQKGVIHRDLKPSNVLVSEIDGRPMPGVIDFGIAVDATNPGMTYAHDRGTPGYMSPEQARGAQDVDARSDIYALGAMFYELSCGLAPVAGRDGVPQPPSQRVAAVPADARARICAARATTYQKLHEQLRDGLDAIVLRALEPQPGARYASVSALLDDLHRWLD
PDBID:9eep
Status:HPUB -- hold until publication
Title:Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP and succinate
Authors:Patterson, M.G., Miller, R.C., Ando, N.
Deposition date:2024-11-19
PDBID:9eel
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, CTP, UTP, and Mg2+
Authors:Miller, R.C., Ando, N.
Deposition date:2024-11-19
PDBID:9hge
Status:HPUB -- hold until publication
Title:PB1 domain of p62/SQSTM1
Authors:Berkamp, S., Jungbluth, L., Katranidis, A., Mostafavi, S., Sachse, C.
Deposition date:2024-11-19
PDBID:9edr
Status:HPUB -- hold until publication
Title:Tubulin Cofactors D,E,G,C and Tubulin complex -- TBCC N Terminus Bound to Tubulin
Authors:Taheri, A., Al-bassam, J.
Deposition date:2024-11-17
PDBID:9kly
Status:HPUB -- hold until publication
Title:Crystal Structure of the bromodomain of human BRD9 in complex with the inhibitor Y22032
Authors:Chen, Z., Zhang, C., Xu, H., Wu, X., Zhang, Y., Xu, Y.
Deposition date:2024-11-15
PDBID:9km1
Status:HPUB -- hold until publication
Title:Crystal Structure of the bromodomain of human BRD9 in complex with the inhibitor Y22077
Authors:Chen, Z., Zhang, C., Xu, H., Wu, X., Zhang, Y., Xu, Y.
Deposition date:2024-11-15
PDBID:9kla
Status:HPUB -- hold until publication
Title:Crystal Structure of the bromodomain of human BRD9 in complex with the inhibitor Y22024
Authors:Chen, Z., Zhang, C., Xu, H., Wu, X., Zhang, Y., Xu, Y.
Deposition date:2024-11-14
PDBID:9het
Status:HPUB -- hold until publication
Title:MscS1Q78W from Halomonas elongata
Authors:Fischer, F., Ziegler, C.
Deposition date:2024-11-14
PDBID:9kkd
Status:HPUB -- hold until publication
Title:the structure of StnY
Authors:Yang, S.Q., Guo, W.L., Yang, X., Liang, R.B., Huang, T.T., Fan, C.P., Zheng, J.T., Lin, S.J.
Deposition date:2024-11-13
PDBID:9kkm
Status:AUTH -- processed, waiting for author review and approval
Title:cryo-EM structure of acetyl-CoA carboxyltransferase holoenzyme dimer from Shewanella oneidensis, mutant E1238A, complexed with ADP
Authors:Wang, W., Han, S.R., Xu, Y.Y., Gao, H.C.
Deposition date:2024-11-13

242500

PDB entries from 2025-10-01

PDB statisticsPDBj update infoContact PDBjnumon