Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9qro
Status:HPUB -- hold until publication
Title:HINT1 complexed with GS-441524-MP
Authors:Zimberger, C., Ferron, F.
Deposition date:2025-04-04
Sequence:

>Entity 1


MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
PDBID:9qrq
Status:HPUB -- hold until publication
Title:Structure of glycocin glycosyltransferase SacS from Streptomyces platensis
Authors:Krummhaar, M., Langhans, A., Singh, M., Seeberger, P.H., Koksch, B., Roth, C.
Deposition date:2025-04-04
PDBID:9qrr
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of glycocin glycosyltransferase SacS from Streptomyces platensis
Authors:Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C.
Deposition date:2025-04-04
PDBID:9qsa
Status:HPUB -- hold until publication
Title:Mouse Ribosome rotated-1 PRE state
Authors:Santo, P.E., Astier, A., Plisson-Chastang, C.
Deposition date:2025-04-04
PDBID:9o18
Status:HPUB -- hold until publication
Title:Fab1504 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-04-03
PDBID:9ubs
Status:HPUB -- hold until publication
Title:The structure of the AglA_T220R-Arg complex
Authors:Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W.
Deposition date:2025-04-03
PDBID:9ubt
Status:HPUB -- hold until publication
Title:The structure of the AglA-Ampn-Arg complex
Authors:Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W.
Deposition date:2025-04-03
PDBID:9qr4
Status:HPUB -- hold until publication
Title:InlB392_T336Y: T336Y variant of Listeria monocytogenes InlB (internalin B) residues 36-392
Authors:Geerds, C., Niemann, H.H.
Deposition date:2025-04-03
PDBID:9ub2
Status:HPUB -- hold until publication
Title:Crystal structure of human DHODH in complex with inhibitor 006
Authors:Jun, L., Zhaomin, X., Caiyue, C., Yuanyuan, Z., Jin, H.
Deposition date:2025-04-02
Release date:2026-04-02
PDBID:9ub9
Status:HPUB -- hold until publication
Title:Wild-type Bacillus megaterium Penicillin G Acylase
Authors:Kaewsasan, C., Rojviriya, C., Yuvaniyama, J.
Deposition date:2025-04-02
PDBID:9ub3
Status:HPUB -- hold until publication
Title:The structure of the apo-AglA from Streptomyces monomycini
Authors:Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W.
Deposition date:2025-04-02
PDBID:9uba
Status:HPUB -- hold until publication
Title:The structure of the AglA_K196R-Arg complex
Authors:Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W.
Deposition date:2025-04-02
PDBID:9ubb
Status:HPUB -- hold until publication
Title:The structure of the AglA_K225E-Arg complex
Authors:Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W.
Deposition date:2025-04-02
PDBID:9ub5
Status:HPUB -- hold until publication
Title:The structure of the AglA-Arg complex
Authors:Sun, Y., Dou, C., Yan, W., Zhou, D., Zhu, X., Cheng, W.
Deposition date:2025-04-02
PDBID:9uay
Status:HPUB -- hold until publication
Title:Crystal structure of CmnI
Authors:Hsiao, P.Y., Chang, C.Y., Peng, C.Y.
Deposition date:2025-04-01
PDBID:9o03
Status:HPUB -- hold until publication
Title:Crystal structure of AfOgg1:8OG-DNA duplex in a product-bound state
Authors:Arvai, A.S., Syed, A., Huffman, J.L., Mol, C.D., Hitomi, K., Tainer, J.A.
Deposition date:2025-04-01
PDBID:9o02
Status:HPUB -- hold until publication
Title:Crystal structure of AfOgg1-K122S mutant bound to 8-OG DNA duplex in an intermediate state
Authors:Huffman, J.L., Syed, A., Tang, H.Y.H., Arvai, A.S., Mol, C.D., Tainer, J.A.
Deposition date:2025-04-01
PDBID:9qqp
Status:HPUB -- hold until publication
Title:Mouse Ribosome rotated-2 PRE state
Authors:Santo, P.E., Astier, A., Plisson-Chastang, C.
Deposition date:2025-04-01
PDBID:9qql
Status:HPUB -- hold until publication
Title:Mouse RPS15 P131 Mutant Ribosome POST translocation state
Authors:Santo, P.E., Astier, A., Plisson-Chastang, C.
Deposition date:2025-04-01
PDBID:9qqj
Status:HPUB -- hold until publication
Title:ERK2 with an inhibitor
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C.
Deposition date:2025-04-01
PDBID:9nzc
Status:HPUB -- hold until publication
Title:Crystal structure of AfNth1:Tg-DNA duplex complex in a pre-intermediate state
Authors:Syed, A., Arvai, A.S., Tsai, C.L., Tainer, J.A.
Deposition date:2025-03-31
PDBID:9ua5
Status:AUTH -- processed, waiting for author review and approval
Title:RABV G binding with CTB011 Fab and CTB012 Fab
Authors:Cao, L., Zhang, C.
Deposition date:2025-03-31
PDBID:9qqc
Status:HPUB -- hold until publication
Title:Acoustofluidic Sample Delivery System for Serial Crystallography, Thaumatin with acoustic ON
Authors:Bjelcic, M., Sellberg, J., Rajendran, K.V., Casadei, C., Viklund, T.E.
Deposition date:2025-03-31
PDBID:9qqg
Status:HPUB -- hold until publication
Title:Acoustofluidic Sample Delivery System for Serial Crystallography, Thaumatin with acoustic OFF
Authors:Bjelcic, M., Sellberg, J., Rajendran, K.V., Casadei, C., Viklund, T.E.
Deposition date:2025-03-31
PDBID:9qpg
Status:HPUB -- hold until publication
Title:Isopenicillin N synthase in complex with Fe and IPN
Authors:Rabe, P., Schofield, C.J.
Deposition date:2025-03-27

245396

PDB entries from 2025-11-26

PDB statisticsPDBj update infoContact PDBjnumon