PDBID: | 9nj4 | Status: | HPUB -- hold until publication | Title: | Fab1437 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | Authors: | Moskovitz, R., Wilson, I.A. | Deposition date: | 2025-02-26 |
|
PDBID: | 9q8r | Status: | HPUB -- hold until publication | Title: | Human ROCK1 in complex with a dihydropyrazolo-pyrimidine inhibitor | Authors: | Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C. | Deposition date: | 2025-02-25 | Sequence: | >Entity 1 GASFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRY
|
|
PDBID: | 9q8t | Status: | HPUB -- hold until publication | Title: | Nociceptive properties of U5-theraphotoxin-Hs1b, a novel peptide from the Cyriopagopus schmidti spider, active on NaV1.7 channel | Authors: | Meudal, H., Landon, C. | Deposition date: | 2025-02-25 |
|
PDBID: | 9q8x | Status: | HPUB -- hold until publication | Title: | Ku70/80 bound to a 153 bp H2AX nucleosome | Authors: | Hall, C., Chaplin, A.K. | Deposition date: | 2025-02-25 |
|
PDBID: | 9q8q | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNKK2A2 gene product) in complex with F2X-Entry screen fragment E03 | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-25 |
|
PDBID: | 9nhy | Status: | HPUB -- hold until publication | Title: | Fab1502 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | Authors: | Moskovitz, R., Wilson, I.A. | Deposition date: | 2025-02-25 |
|
PDBID: | 9ni2 | Status: | HPUB -- hold until publication | Title: | Fab369 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | Authors: | Moskovitz, R., Wilson, I.A. | Deposition date: | 2025-02-25 |
|
PDBID: | 9ni1 | Status: | HPUB -- hold until publication | Title: | Fab389 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | Authors: | Moskovitz, R., Wilson, I.A. | Deposition date: | 2025-02-25 |
|
PDBID: | 9ihg | Status: | AUTH -- processed, waiting for author review and approval | Title: | Protein kinase CK2 catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment C02 | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-21 |
|
PDBID: | 9ihi | Status: | AUTH -- processed, waiting for author review and approval | Title: | Protein kinase CK2 catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D02 | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-21 |
|
PDBID: | 9lyu | Status: | HPUB -- hold until publication | Title: | Crystal structure of glycerol kinase from Entamoeba histolytica (Ligand-free form) | Authors: | Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T. | Deposition date: | 2025-02-21 |
|
PDBID: | 9lyy | Status: | HPUB -- hold until publication | Title: | Crystal structure of glycerol kinase from Entamoeba histolytica complexed with ADP and G3P. | Authors: | Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T. | Deposition date: | 2025-02-21 |
|
PDBID: | 9lzg | Status: | HPUB -- hold until publication | Title: | Crystal structure of glycerol kinase from Entamoeba histolytica complexed with daphnetin. | Authors: | Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T. | Deposition date: | 2025-02-21 |
|
PDBID: | 9lzi | Status: | HPUB -- hold until publication | Title: | Crystal structure of glycerol kinase from Entamoeba histolytica complexed with GK-butyl. | Authors: | Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T. | Deposition date: | 2025-02-21 |
|
PDBID: | 9lyx | Status: | AUTH -- processed, waiting for author review and approval | Title: | hCTPS1 with CTP and DON | Authors: | Guo, C.J., Bao, X.J., Liu, J.L. | Deposition date: | 2025-02-21 |
|
PDBID: | 9lyv | Status: | HPUB -- hold until publication | Title: | structure of prrx bound to DNA | Authors: | Dong, C., Yan, X.J., Guo, S.M., Huang, Y.L. | Deposition date: | 2025-02-21 |
|
PDBID: | 9igw | Status: | HPUB -- hold until publication | Title: | Ku70/80 bound to 147 bp nucleosome | Authors: | Hall, C., Chaplin, A.K. | Deposition date: | 2025-02-20 |
|
PDBID: | 9igy | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of a Chimeric Protein Composed of the SNX5 PhoX Domain and the N-terminal domain of NCOA7-AS,crystal form II | Authors: | Arnaud-Arnould, M., Rebendenne, A., Tauziet, M., Urbach, S., El Koulali, K., Ricci, E., Wencker, M., Moncorge, O., Blaise, M., Goujon, C. | Deposition date: | 2025-02-20 |
|
PDBID: | 9igx | Status: | AUTH -- processed, waiting for author review and approval | Title: | Ku70/80 bound to 153 bp nucleosome | Authors: | Hall, C., Chaplin, A.K. | Deposition date: | 2025-02-20 |
|
PDBID: | 9lyn | Status: | AUTH -- processed, waiting for author review and approval | Title: | The electron diffraction structure of photosensitizer protein PSP2 | Authors: | Zhao, Y.M., Qi, C. | Deposition date: | 2025-02-20 |
|
PDBID: | 9lys | Status: | HPUB -- hold until publication | Title: | Crystal structure of de novo designed amantadine binding homotrimer dAIT03 | Authors: | Qihan, J., Longxing, C. | Deposition date: | 2025-02-20 |
|
PDBID: | 9nf2 | Status: | HPUB -- hold until publication | Title: | KRAS G12D Mutant KRAS 1-169 at 298 K bound to MRTX-1133 and GMPPNP | Authors: | Xu, M., Deck, S.L., Milano, S.K., Aplin, C., Cerione, R.A. | Deposition date: | 2025-02-20 |
|
PDBID: | 9lya | Status: | HPUB -- hold until publication | Title: | Crystal structure of PAS domain in NreB protein | Authors: | Xia, Y., Xun, L., Tang, C. | Deposition date: | 2025-02-19 |
|
PDBID: | 9ifk | Status: | HPUB -- hold until publication | Title: | Crystal structure of Kalirin/Rac1 in complex with DK-2 | Authors: | Gray, J.L., Zaidman, D., Callens, M.C., von Delft, F., London, N., Brennan, P.E. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ife | Status: | HPUB -- hold until publication | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z943693514 | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | Deposition date: | 2025-02-18 |
|