Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9nj4
Status:HPUB -- hold until publication
Title:Fab1437 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-26
PDBID:9q8r
Status:HPUB -- hold until publication
Title:Human ROCK1 in complex with a dihydropyrazolo-pyrimidine inhibitor
Authors:Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C.
Deposition date:2025-02-25
Sequence:

>Entity 1


GASFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRY
PDBID:9q8t
Status:HPUB -- hold until publication
Title:Nociceptive properties of U5-theraphotoxin-Hs1b, a novel peptide from the Cyriopagopus schmidti spider, active on NaV1.7 channel
Authors:Meudal, H., Landon, C.
Deposition date:2025-02-25
PDBID:9q8x
Status:HPUB -- hold until publication
Title:Ku70/80 bound to a 153 bp H2AX nucleosome
Authors:Hall, C., Chaplin, A.K.
Deposition date:2025-02-25
PDBID:9q8q
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNKK2A2 gene product) in complex with F2X-Entry screen fragment E03
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-25
PDBID:9nhy
Status:HPUB -- hold until publication
Title:Fab1502 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-25
PDBID:9ni2
Status:HPUB -- hold until publication
Title:Fab369 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-25
PDBID:9ni1
Status:HPUB -- hold until publication
Title:Fab389 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-02-25
PDBID:9ihg
Status:AUTH -- processed, waiting for author review and approval
Title:Protein kinase CK2 catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment C02
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-21
PDBID:9ihi
Status:AUTH -- processed, waiting for author review and approval
Title:Protein kinase CK2 catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment D02
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-21
PDBID:9lyu
Status:HPUB -- hold until publication
Title:Crystal structure of glycerol kinase from Entamoeba histolytica (Ligand-free form)
Authors:Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T.
Deposition date:2025-02-21
PDBID:9lyy
Status:HPUB -- hold until publication
Title:Crystal structure of glycerol kinase from Entamoeba histolytica complexed with ADP and G3P.
Authors:Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T.
Deposition date:2025-02-21
PDBID:9lzg
Status:HPUB -- hold until publication
Title:Crystal structure of glycerol kinase from Entamoeba histolytica complexed with daphnetin.
Authors:Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T.
Deposition date:2025-02-21
PDBID:9lzi
Status:HPUB -- hold until publication
Title:Crystal structure of glycerol kinase from Entamoeba histolytica complexed with GK-butyl.
Authors:Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T.
Deposition date:2025-02-21
PDBID:9lyx
Status:AUTH -- processed, waiting for author review and approval
Title:hCTPS1 with CTP and DON
Authors:Guo, C.J., Bao, X.J., Liu, J.L.
Deposition date:2025-02-21
PDBID:9lyv
Status:HPUB -- hold until publication
Title:structure of prrx bound to DNA
Authors:Dong, C., Yan, X.J., Guo, S.M., Huang, Y.L.
Deposition date:2025-02-21
PDBID:9igw
Status:HPUB -- hold until publication
Title:Ku70/80 bound to 147 bp nucleosome
Authors:Hall, C., Chaplin, A.K.
Deposition date:2025-02-20
PDBID:9igy
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of a Chimeric Protein Composed of the SNX5 PhoX Domain and the N-terminal domain of NCOA7-AS,crystal form II
Authors:Arnaud-Arnould, M., Rebendenne, A., Tauziet, M., Urbach, S., El Koulali, K., Ricci, E., Wencker, M., Moncorge, O., Blaise, M., Goujon, C.
Deposition date:2025-02-20
PDBID:9igx
Status:AUTH -- processed, waiting for author review and approval
Title:Ku70/80 bound to 153 bp nucleosome
Authors:Hall, C., Chaplin, A.K.
Deposition date:2025-02-20
PDBID:9lyn
Status:AUTH -- processed, waiting for author review and approval
Title:The electron diffraction structure of photosensitizer protein PSP2
Authors:Zhao, Y.M., Qi, C.
Deposition date:2025-02-20
PDBID:9lys
Status:HPUB -- hold until publication
Title:Crystal structure of de novo designed amantadine binding homotrimer dAIT03
Authors:Qihan, J., Longxing, C.
Deposition date:2025-02-20
PDBID:9nf2
Status:HPUB -- hold until publication
Title:KRAS G12D Mutant KRAS 1-169 at 298 K bound to MRTX-1133 and GMPPNP
Authors:Xu, M., Deck, S.L., Milano, S.K., Aplin, C., Cerione, R.A.
Deposition date:2025-02-20
PDBID:9lya
Status:HPUB -- hold until publication
Title:Crystal structure of PAS domain in NreB protein
Authors:Xia, Y., Xun, L., Tang, C.
Deposition date:2025-02-19
PDBID:9ifk
Status:HPUB -- hold until publication
Title:Crystal structure of Kalirin/Rac1 in complex with DK-2
Authors:Gray, J.L., Zaidman, D., Callens, M.C., von Delft, F., London, N., Brennan, P.E.
Deposition date:2025-02-18
PDBID:9ife
Status:HPUB -- hold until publication
Title:PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z943693514
Authors:Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A.
Deposition date:2025-02-18

243083

PDB entries from 2025-10-15

PDB statisticsPDBj update infoContact PDBjnumon