Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9kpb
Status:HPUB -- hold until publication
Title:Crystal structure of human CASTOR2 in apo form
Authors:Liu, C., Ding, J., Zhang, T.
Deposition date:2024-11-22
PDBID:9kpg
Status:HPUB -- hold until publication
Title:Crystal structure of human CASTOR2-arginine
Authors:Liu, C., Ding, J., Zhang, T.
Deposition date:2024-11-22
PDBID:9kp4
Status:HPUB -- hold until publication
Title:Crystal structure of human CASTOR1 in apo form
Authors:Liu, C., Ding, J., Zhang, T.
Deposition date:2024-11-22
PDBID:9kp8
Status:HPUB -- hold until publication
Title:Crystal structure of FAD-dependent oxidase CpaO
Authors:Chang, C.Y., Kuo, Y.M., Cheng, T., Liang, C.H., Hsiao, P.Y., Lin, Y.C., Wang, N.
Deposition date:2024-11-22
PDBID:9kpc
Status:HPUB -- hold until publication
Title:Crystal structure of PRRX2 homeobox domain bound to DNA motif
Authors:Dong, C., Yan, X., Huang, Y., Guo, S.
Deposition date:2024-11-22
PDBID:9kp1
Status:HOLD -- hold until a certain date
Title:Heterodimer of heptaprenyl diphosphate synthase from B. subtilis
Authors:Luo, S., Liu, Z.C., Wang, G.G.
Deposition date:2024-11-22
Release date:2025-11-22
PDBID:9hhh
Status:HPUB -- hold until publication
Title:A rare open conformation for Ubl2 domain of papain-like protease C111S of SARS-CoV2
Authors:Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E.
Deposition date:2024-11-21
Sequence:

>Entity 1


EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
PDBID:9hhg
Status:HPUB -- hold until publication
Title:A rare open conformation for Ubl2 domain of papain-like protease of SARS-CoV2
Authors:Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E.
Deposition date:2024-11-21
Sequence:

>Entity 1


EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
PDBID:9hhi
Status:HPUB -- hold until publication
Title:A rare open conformation for Ubl2 domain of papain-like protease without zinc of SARS-CoV2
Authors:Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E.
Deposition date:2024-11-21
Sequence:

>Entity 1


EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
PDBID:9kos
Status:HPUB -- hold until publication
Title:Crystal structure of RaTG13 RBD complexed with sheep ACE2
Authors:Lan, J., Wang, C.H.
Deposition date:2024-11-21
PDBID:9kow
Status:HPUB -- hold until publication
Title:Crystal structure of RaTG13 RBD complexed with cattle ACE2
Authors:Lan, J., Wang, C.H.
Deposition date:2024-11-21
PDBID:9eg9
Status:HPUB -- hold until publication
Title:Crystal structure of human dihydroorotate dehydrogenase in complex with lapachol
Authors:Purificacao, A.D., Benz, L.S., Weiss, M.S., Nonato, M.C.
Deposition date:2024-11-21
PDBID:9hgp
Status:HPUB -- hold until publication
Title:Human Carbonic Anhydrase II in complex with a synthetic aromatic oligoamide foldamer
Authors:Sigl, J.C., Wang, L., Huc, I.
Deposition date:2024-11-20
PDBID:9koa
Status:HPUB -- hold until publication
Title:Crystal structure of SARS-CoV-2 3C-like protease double mutant (T21I and E166A) in complex with inhibitor simnotrelvir
Authors:Nie, T.Q., Su, H.X., Li, M.J., Xu, Y.C.
Deposition date:2024-11-20
PDBID:9koc
Status:HPUB -- hold until publication
Title:Crystal structure of SARS-CoV-2 3C-like protease double mutant (T21I and E166A) in complex with inhibitor ensitrelvir
Authors:Nie, T.Q., Su, H.X., Li, M.J., Xu, Y.C.
Deposition date:2024-11-20
PDBID:9ko7
Status:HPUB -- hold until publication
Title:Crystal structure of chicken ACE2
Authors:Lan, J., Wang, C.H.
Deposition date:2024-11-20
PDBID:9hge
Status:HPUB -- hold until publication
Title:PB1 domain of p62/SQSTM1
Authors:Berkamp, S., Jungbluth, L., Katranidis, A., Mostafavi, S., Sachse, C.
Deposition date:2024-11-19
PDBID:9eeo
Status:HPUB -- hold until publication
Title:Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, CTP, and Mg2+
Authors:Patterson, M.G., Miller, R.C., Ando, N.
Deposition date:2024-11-19
PDBID:9eep
Status:HPUB -- hold until publication
Title:Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP and succinate
Authors:Patterson, M.G., Miller, R.C., Ando, N.
Deposition date:2024-11-19
PDBID:9eeq
Status:HPUB -- hold until publication
Title:Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, and Mg2+
Authors:Patterson, M.G., Miller, R.C., Ando, N.
Deposition date:2024-11-19
PDBID:9eeu
Status:HPUB -- hold until publication
Title:Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, ATP, and Mg2+
Authors:Patterson, M.G., Miller, R.C., Ando, N.
Deposition date:2024-11-19
PDBID:9eer
Status:HPUB -- hold until publication
Title:Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, GTP, and Mg2+
Authors:Patterson, M.G., Miller, R.C., Ando, N.
Deposition date:2024-11-19
PDBID:9eej
Status:HPUB -- hold until publication
Title:Crystal structure of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, and Mg2+
Authors:Patterson, M.G., Miller, R.C., Ando, N.
Deposition date:2024-11-19
PDBID:9een
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, CTP, and Mg2+
Authors:Miller, R.C., Ando, N.
Deposition date:2024-11-19
PDBID:9ef1
Status:HPUB -- hold until publication
Title:Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with one DILP1, asymmetric conformation
Authors:Bai, X.C.
Deposition date:2024-11-19

237735

PDB entries from 2025-06-18

PDB statisticsPDBj update infoContact PDBjnumon