Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9m4m
Status:HPUB -- hold until publication
Title:Crystal structure of human DHODH in complex with Lapachol derivatives, 511-12
Authors:Pemba, M.C., Sakurai, Y., Kurosaki, Y., Amalia, E., Inaoka, D.K., Davey, A.R., Shiba, T., Kita, K., Yasuda, J.
Deposition date:2025-03-04
PDBID:9m4o
Status:HPUB -- hold until publication
Title:Crystal structure of human DHODH in complex with Lapachol
Authors:Pemba, M.C., Sakurai, Y., Kurosaki, Y., Amalia, E., Inaoka, D.K., Davey, A.R., Shiba, T., Kita, K., Yasuda, J.
Deposition date:2025-03-04
PDBID:9qbv
Status:HPUB -- hold until publication
Title:Crystal structure of WRN in complex with (R)-11 (GSK4766470)
Authors:Chaikuad, A., Concha, N., Chun, C.-W.
Deposition date:2025-03-03
PDBID:9qbu
Status:HPUB -- hold until publication
Title:Crystal structure of WRN in complex with (S)-27 (GSK5819992)
Authors:Chaikuad, A., Chun, C.-W.
Deposition date:2025-03-03
PDBID:7i23
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0016618-001 (A71EV2A-x1346)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-03
PDBID:7i24
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0016733-001 (A71EV2A-x1445)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-03
PDBID:7i25
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0025240-002 (A71EV2A-x1778)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-03
PDBID:7i27
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0018402-002 (A71EV2A-x2458)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-03
PDBID:7i26
Status:AUTH -- processed, waiting for author review and approval
Title:Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0030304-001 (A71EV2A-x2304)
Authors:Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F.
Deposition date:2025-03-03
PDBID:9nli
Status:AUTH -- processed, waiting for author review and approval
Title:GloR, native, unmodified
Authors:Cuthbert, B.J., de Miranda, R., Martinez, J., Goulding, C.W.
Deposition date:2025-03-03
Release date:2026-03-03
PDBID:9nla
Status:AUTH -- processed, waiting for author review and approval
Title:[CC-5x_Ag6] Tensegrity triangle structure with a C:C base pair hosting a templated 6-atom silver nanocluster
Authors:Vecchioni, S., Perren, L., Sha, R., Ohayon, Y.P.
Deposition date:2025-03-02
PDBID:9qb9
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with a heparin-derived trisaccharide and the ATP-competitive inhibitor 4w
Authors:Werner, C., Harasimowicz, H., Weiss, M.S., Niefind, K.
Deposition date:2025-03-01
PDBID:9nkv
Status:AUTH -- processed, waiting for author review and approval
Title:[CC-5x_Ag4] Tensegrity triangle structure with a C:C base pair hosting a templated 4-atom silver nanocluster
Authors:Vecchioni, S., Perren, L., Sha, R., Ohayon, Y.P.
Deposition date:2025-03-01
PDBID:9qak
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment G07
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-28
PDBID:9qb6
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment H02 and CX-4945 (Silmitasertib)
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-28
PDBID:9qb0
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment H07
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-28
PDBID:9qam
Status:HPUB -- hold until publication
Title:Human angiotensin-1 converting enzyme C-domain in complex with ciprofloxacin
Authors:Gregory, K.S., Acharya, K.R.
Deposition date:2025-02-28
PDBID:9qab
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment E11 and CX-4945 (Silmitasertib)
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-28
PDBID:9qag
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment FF08 and CX-4945 (Silmitasertib)
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-28
PDBID:9qah
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment G04 and CX-4945 (Silmitasertib)
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-28
PDBID:9m2t
Status:HPUB -- hold until publication
Title:Crystal structure of glycerol kinase from Entamoeba histolytica complexed with AMP-PNP and glycerol.
Authors:Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T.
Deposition date:2025-02-28
PDBID:9njw
Status:HPUB -- hold until publication
Title:Structure of ancestral-reconstructed cytochrome P450 11A1 (CYP11A1) in complex with cholesterol
Authors:Chagas, B.C., Wang, P.C., Brixius-Anderko, S.
Deposition date:2025-02-28
PDBID:9njm
Status:HPUB -- hold until publication
Title:hMCT1-BSGiso2-INX444
Authors:Lo, Y.-H., Dorsey, F.C.
Deposition date:2025-02-27
PDBID:9q9t
Status:HPUB -- hold until publication
Title:Human ROCK2 in complex with a dihydropyrazolo-pyrimidine inhibitor
Authors:Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C.
Deposition date:2025-02-26
Sequence:

>Entity 1


GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
PDBID:9q9b
Status:HPUB -- hold until publication
Title:CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment C07
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-02-26

242842

PDB entries from 2025-10-08

PDB statisticsPDBj update infoContact PDBjnumon