PDBID: | 9m4m | Status: | HPUB -- hold until publication | Title: | Crystal structure of human DHODH in complex with Lapachol derivatives, 511-12 | Authors: | Pemba, M.C., Sakurai, Y., Kurosaki, Y., Amalia, E., Inaoka, D.K., Davey, A.R., Shiba, T., Kita, K., Yasuda, J. | Deposition date: | 2025-03-04 |
|
PDBID: | 9m4o | Status: | HPUB -- hold until publication | Title: | Crystal structure of human DHODH in complex with Lapachol | Authors: | Pemba, M.C., Sakurai, Y., Kurosaki, Y., Amalia, E., Inaoka, D.K., Davey, A.R., Shiba, T., Kita, K., Yasuda, J. | Deposition date: | 2025-03-04 |
|
PDBID: | 9qbv | Status: | HPUB -- hold until publication | Title: | Crystal structure of WRN in complex with (R)-11 (GSK4766470) | Authors: | Chaikuad, A., Concha, N., Chun, C.-W. | Deposition date: | 2025-03-03 |
|
PDBID: | 9qbu | Status: | HPUB -- hold until publication | Title: | Crystal structure of WRN in complex with (S)-27 (GSK5819992) | Authors: | Chaikuad, A., Chun, C.-W. | Deposition date: | 2025-03-03 |
|
PDBID: | 7i23 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0016618-001 (A71EV2A-x1346) | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | Deposition date: | 2025-03-03 |
|
PDBID: | 7i24 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0016733-001 (A71EV2A-x1445) | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | Deposition date: | 2025-03-03 |
|
PDBID: | 7i25 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0025240-002 (A71EV2A-x1778) | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | Deposition date: | 2025-03-03 |
|
PDBID: | 7i27 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0018402-002 (A71EV2A-x2458) | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | Deposition date: | 2025-03-03 |
|
PDBID: | 7i26 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0030304-001 (A71EV2A-x2304) | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | Deposition date: | 2025-03-03 |
|
PDBID: | 9nli | Status: | AUTH -- processed, waiting for author review and approval | Title: | GloR, native, unmodified | Authors: | Cuthbert, B.J., de Miranda, R., Martinez, J., Goulding, C.W. | Deposition date: | 2025-03-03 | Release date: | 2026-03-03 |
|
PDBID: | 9nla | Status: | AUTH -- processed, waiting for author review and approval | Title: | [CC-5x_Ag6] Tensegrity triangle structure with a C:C base pair hosting a templated 6-atom silver nanocluster | Authors: | Vecchioni, S., Perren, L., Sha, R., Ohayon, Y.P. | Deposition date: | 2025-03-02 |
|
PDBID: | 9qb9 | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with a heparin-derived trisaccharide and the ATP-competitive inhibitor 4w | Authors: | Werner, C., Harasimowicz, H., Weiss, M.S., Niefind, K. | Deposition date: | 2025-03-01 |
|
PDBID: | 9nkv | Status: | AUTH -- processed, waiting for author review and approval | Title: | [CC-5x_Ag4] Tensegrity triangle structure with a C:C base pair hosting a templated 4-atom silver nanocluster | Authors: | Vecchioni, S., Perren, L., Sha, R., Ohayon, Y.P. | Deposition date: | 2025-03-01 |
|
PDBID: | 9qak | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment G07 | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-28 |
|
PDBID: | 9qb6 | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment H02 and CX-4945 (Silmitasertib) | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-28 |
|
PDBID: | 9qb0 | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment H07 | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-28 |
|
PDBID: | 9qam | Status: | HPUB -- hold until publication | Title: | Human angiotensin-1 converting enzyme C-domain in complex with ciprofloxacin | Authors: | Gregory, K.S., Acharya, K.R. | Deposition date: | 2025-02-28 |
|
PDBID: | 9qab | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment E11 and CX-4945 (Silmitasertib) | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-28 |
|
PDBID: | 9qag | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment FF08 and CX-4945 (Silmitasertib) | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-28 |
|
PDBID: | 9qah | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment G04 and CX-4945 (Silmitasertib) | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-28 |
|
PDBID: | 9m2t | Status: | HPUB -- hold until publication | Title: | Crystal structure of glycerol kinase from Entamoeba histolytica complexed with AMP-PNP and glycerol. | Authors: | Balogun, E.O., Jeelani, G., Hane, E., Kondo, H., Hasegawa, Y., Kojima, C., Chishima, T., Harada, S., Kishikawa, J., Nozaki, T., Shiba, T. | Deposition date: | 2025-02-28 |
|
PDBID: | 9njw | Status: | HPUB -- hold until publication | Title: | Structure of ancestral-reconstructed cytochrome P450 11A1 (CYP11A1) in complex with cholesterol | Authors: | Chagas, B.C., Wang, P.C., Brixius-Anderko, S. | Deposition date: | 2025-02-28 |
|
PDBID: | 9njm | Status: | HPUB -- hold until publication | Title: | hMCT1-BSGiso2-INX444 | Authors: | Lo, Y.-H., Dorsey, F.C. | Deposition date: | 2025-02-27 |
|
PDBID: | 9q9t | Status: | HPUB -- hold until publication | Title: | Human ROCK2 in complex with a dihydropyrazolo-pyrimidine inhibitor | Authors: | Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C. | Deposition date: | 2025-02-26 | Sequence: | >Entity 1 GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
PDBID: | 9q9b | Status: | HPUB -- hold until publication | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment C07 | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | Deposition date: | 2025-02-26 |
|