| PDBID: | 9ga8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure of human Annexin A4 from crystals grown at 4 mM Calcium | | Authors: | Ruggiero, A., Barra, G., Ghilardi, O., Scala, M.C., Sala, M., Di Micco, S., Bifulco, G., Campiglia, P., Vitagliano, L. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ga3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | MtUvrA2UvrB bound to damaged oligonucleotide | | Authors: | Genta, M., Capelli, R., Ferrara, G., Rizzi, M., Rossi, F., Jeruzalmi, D., Bolognesi, M., Chaves-Sanjuan, A., Miggiano, R. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ga4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ga5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | MtUvrA2 bound to endogenous E. coli DNA | | Authors: | Genta, M., Capelli, R., Ferrara, G., Rizzi, M., Rossi, F., Jeruzalmi, D., Bolognesi, M., Chaves-Sanjuan, A., Miggiano, R. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ga0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | XPA crystal grown in HEK293 cell | | Authors: | Melicher, F., Isabet, T., Chavas, L.M.G., Montaville, P. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9gae | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Respiratory supercomplex CI1-CIII2-CIV2 from alphaproteobacterium | | Authors: | Yaikhomba, M., Hirst, J., Croll, T.I., Spikes, T.E. | | Deposition date: | 2024-07-26 | | Release date: | 2025-07-26 |
|
| PDBID: | 9ga2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9iww | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with GSK''872 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9iwx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the mouse RIP3 kinase domain(R69H) in complexed with GSK''872 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9iwy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with LK01003 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9iwz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with GSK''843 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with GW''39B | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with PP2 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with TAK-632 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the mouse RIP3 kinase domain in complexed with compound 18 | | Authors: | Xie, H., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Mutant H286T Crystal Structure of Two-domain bacterial laccase from the actinobacterium Streptomyces carpinensis VKM Ac-1300 | | Authors: | Gabdulkhakov, A.G., Tishchenko, T.V., Trubitsina, L., Trubitsin, I., Leontievsky, A., Lisov, A. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix8 | | Status: | HPUB -- hold until publication | | Title: | Crystallization and structural characterization of phosphopentomutase from the hyperthermophilic archaeon Thermococcus kodakarensis | | Authors: | Naz, Z., Lubkowski, T.J., Saleem, M., Rahman, M., Wlodawer, A., Rashid, N. | | Deposition date: | 2024-07-26 | | Sequence: | >Entity 1
RLFGTAGIRGTLWEKVTPELAMKVGMAVGTYKSGKALVGRDGRTSSVMLKNAMISGLLSTGMEVLDADLIPTPALAWGTRKLADAGVMITASHNPPTDNGVKVFNGDGTEFYVEQERGLEEIIFSGNFRKARWDEIKPVRNVEVIPDYINAVLDFVGHETNLKVLYDGANGAGSLVAPYLLREMGAKVLSVNAHVDGHFPGRKPEPRYENIAYLGKLVRELGVDLAIAQDGDADRIAVFDEKGNYVDEDTVIALFAKLYVEEHGGGTVVVSIDTGSRIDAVVERAGGRVVRIPLGQPHDGIKRYKAIFAAEPWKLVHPKFGPWIDPFVTMGLLIKLIDENGPLSELVKEIPTYYLKKANVLCPDEYKAEVVRRAAEEVERKLSSEIKEVLTISGFRIALNDGSWILIRPSGTEPKIRVVAEAPTEKRRDELFEMAYSTVSRIVKEAEKK
|
|
| PDBID: | 9iwv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Lsd18 after incubation with the substrate | | Authors: | Wang, Q., Kim, C.Y., Chen, X. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix5 | | Status: | HPUB -- hold until publication | | Title: | An agonist(compound 15n) of Thyroid Hormone Receptor B | | Authors: | Yao, B., Li, Y. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9iwu | | Status: | HPUB -- hold until publication | | Title: | CTB10_M40BpA_M86I-R-1d | | Authors: | Fu, K., Rao, Y.J. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9iwt | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Cas12X2 with crRNA | | Authors: | Xi, Z. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ix7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of homolog of dihydroxyacid dehydratase(AstD) from Aspergillus terreus | | Authors: | Huang, W.X., Zhang, P.X., Zhou, J.H. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ixa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of chikungunya virus glycoprotein E1-E2 with C34 Fab. | | Authors: | Han, X., Ji, C., Wang, F., Tian, S., Gao, F.G., Yan, J. | | Deposition date: | 2024-07-26 |
|
