| PDBID: | 8xhh | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xhj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-HBA complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xh9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xhi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Toxin BmKaTX15-7A | | Authors: | Gu, M.Y. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8xgz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-16 |
|
| PDBID: | 8rho | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Neisseria gonorrhoeae FabI in complex with NADH and (E)-3-((2R,3S)-3-hydroxy-2-methyl-4-oxo-2,3,4,5-tetrahydro-1H-pyrido[2,3-b][1,4]diazepin-8-yl)-N-methyl-N-((3-methylbenzofuran-2-yl)methyl)acrylamide | | Authors: | Ronin, C., Gerusz, V., Ciesielski, F. | | Deposition date: | 2023-12-15 | | Release date: | 2025-06-15 |
|
| PDBID: | 8rhm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 | | Sequence: | >Entity 1
GPGSRTPVELRLTEIFRDVLGHDAFGVLDDFFELGGDSFKAIRIAAKYGPPLEVTDIYDHPTIEALAAHLAR
|
|
| PDBID: | 8rhb | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rhh | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xg4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xg5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xg6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xg9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phenylacetone monooxygenase mutant PM3 bound to FAD and NADP | | Authors: | Li, X., Sun, Z.T. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xg7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phenylacetone monooxygenase mutant PM1 bound to FAD and NADP | | Authors: | Li, X., Sun, Z.T. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xg8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phenylacetone monooxygenase mutant PM2 bound to FAD and NADP | | Authors: | Li, X., Sun, Z.T. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xgx | | Status: | HPUB -- hold until publication | | Title: | beta-1,4-galacosyltransferase | | Authors: | Luo, G., Huang, Z., Chen, J., Hou, X., Zhu, Y., Ni, D., Xu, W., Zhang, W., Rao, Y., Mu, W. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xgj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xgg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xgd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xge | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xgh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xgi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xgp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
