| PDBID: | 8xa3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | C-hexon capsomer of the VZV B-Capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8xa2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Penton capsomer of the VZV B-Capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8xa1 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Portal vertex capsomer of VZV B-capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8xa0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | penton capsomer of the VZV C-capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8x9z | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | P-hexon capsomer of the VZV C-Capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8x9y | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | E-hexon capsomer of the VZV C-Capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8x9x | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | C-hexon capsomer of the VZV C-Capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8x9w | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | portal vertex capsomer of the VZV C-Capsid | | Authors: | Nan, W., Lei, C., Jiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8r9v | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the primed actomyosin-5a complex | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v58 | | Status: | HPUB -- hold until publication | | Title: | Complex of murine cathepsin K with bound heparan sulfate 12mer | | Authors: | Pedersen, L.C., Xu, D., Krahn, J.M. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5p | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the C-terminal domain of the VZV gE ectodomain in complex with the Fab of human antibody 5A2 | | Authors: | Harshbarger, W., Malito, E. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5s | | Status: | HPUB -- hold until publication | | Title: | VZV glycoprotein E C-terminal domain (cleaved) in complex with human Fab 5A2 | | Authors: | Harshbarger, W., Malito, E. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v57 | | Status: | HPUB -- hold until publication | | Title: | Complex of murine cathepsin K with bound cystatin C inhibitor | | Authors: | Pedersen, L.C., Xu, D. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8x9p | | Status: | HPUB -- hold until publication | | Title: | HURP (428-534)-alpha-tubulin-beta-tubulin complex | | Authors: | Chen, P.-P., Hsia, K.-C. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8x7g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of 108 | | Authors: | Dong, C., Yan, X., Li, Y. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8x7h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of 162 | | Authors: | Dong, C., Yan, X., Li, Y. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8r76 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ficin C crystal form I | | Authors: | Loris, R., Baeyens-Volant, D., Azarkan, M., Kerff, F. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8r77 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Ficin C crystal form 2 | | Authors: | Loris, R., Baeyens-Volant, D., Azarkan, M., Kerff, F. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8v2v | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of recifin A [Y6F] | | Authors: | Payne, C.D., Schroeder, C.I., Rosengren, K.J. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8x75 | | Status: | HPUB -- hold until publication | | Title: | Thy Cryo-EM Structure of Bacillus methanolicus Methanol Dehydrogenase | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8x7b | | Status: | PROC -- to be processed | | Title: | ThT-bound E46K mutanted alpha-synuclein fibrils | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8x6t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Peroxiredoxin I in complex with Lithospermic Acid | | Authors: | Zhang, H., Luo, C. | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8v1z | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of monoclonal antibody 1A05 in complex with BA.1 RBD | | Authors: | Bajic, G., Alesandro, C. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8x6d | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the C-terminal TBF1 | | Authors: | Gao, Y., Niu, L.W. | | Deposition date: | 2023-11-21 | | Release date: | 2024-11-21 |
|
| PDBID: | 8v17 | | Status: | HPUB -- hold until publication | | Title: | HIV-CA Disulfide linked Hexamer with inhibitor bound - exploration of a benzothiazole | | Authors: | Goldstone, D.C., Walsham, L.J. | | Deposition date: | 2023-11-19 | | Sequence: | >Entity 1
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR
|
|
