| PDBID: | 9l4e | | Status: | HPUB -- hold until publication | | Title: | Solution Structure of the 2:1 Complex Between the Benzothiazole Derivative BTO-28 and the MYC G-quadruplex | | Authors: | Ni, X., Hu, X., Cao, C. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9l4p | | Status: | HPUB -- hold until publication | | Title: | Arabidopsis thaliana protease-associated domain of vacuolar sorting receptor 1 in complexed with vicilin-like seed storage protein 22 C-terminal pentapeptide SDRFV (pH 7.0) | | Authors: | Lui, S.N., Wong, K.B. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9mmw | | Status: | HPUB -- hold until publication | | Title: | CRISPR-associated deaminase Cad1 in cA4 bound in hexamer form refined against the consensus map | | Authors: | Li, H., Zhao, Y., Whyms, C. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9mn2 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the B6C Region of the Group B Streptococcus Beta Antigen C Protein | | Authors: | Zhang, Y., Geisbrecht, B.V. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9mle | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Asp49 Phospholipase A2 isolated from Lachesis muta | | Authors: | Leonardo, D.A., Vargas, J.A., Pereira, H.M., Garratt, R.C. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hry | | Status: | HPUB -- hold until publication | | Title: | The MK-RSL - pctx complex, P41212 form | | Authors: | Wren, C.W., Mockler, N.M., Crowley, P.B. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9hrz | | Status: | HPUB -- hold until publication | | Title: | The RSL-R6 - pctx complex, H3 form | | Authors: | Wren, C.P., Mockler, N.M., Crowley, P.B. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9hru | | Status: | HPUB -- hold until publication | | Title: | The Lysozyme - pctx complex in space group P3121 | | Authors: | Wren, C.P., Flood, R.J., Crowley, P.B. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9hrv | | Status: | HPUB -- hold until publication | | Title: | The RSL - pctx complex, H3 form | | Authors: | Wren, C.P., Flood, R.J., Mockler, N.M., Crowley, P.B. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9hrw | | Status: | HPUB -- hold until publication | | Title: | The RSL - pctx complex, P63 form | | Authors: | Wren, C.P., Flood, R.J., Crowley, P.B. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9hrx | | Status: | HPUB -- hold until publication | | Title: | The RSL - pctx complex, H32 form | | Authors: | Wren, C.P., Flood, R.J., Crowley, P.B. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9hs8 | | Status: | HPUB -- hold until publication | | Title: | Cytochrome c prime beta from Methylococcus capsulatus (Bath) in complex with nitric oxide from proli NONOate | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9mkv | | Status: | HPUB -- hold until publication | | Title: | FnoCas12a bridge helix variant state 3 | | Authors: | Ganguly, C., Thomas, L.M., Aribam, S.D., Martin, L., Rajan, R. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9mkx | | Status: | HPUB -- hold until publication | | Title: | FnoCas12a bridge helix variant state 4b | | Authors: | Ganguly, C., Thomas, L.M., Aribam, S.D., Martin, L., Rajan, R. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9hqt | | Status: | HPUB -- hold until publication | | Title: | SFX structure of cytochrome c prime beta from Methylococcus capsulatus (Bath) | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9l2o | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure and rational engineering of a novel efficient ochratoxin A-detoxifying amidohydrolase | | Authors: | Dai, L.H., Xu, Y.H., Hu, Y.M., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9l2t | | Status: | HPUB -- hold until publication | | Title: | Cryo-electron microscopic structure of a novel amidohydrolase with three mutations | | Authors: | Dai, L.H., Xu, Y.H., Hu, Y.M., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9l36 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-electron microscopic structure of a novel amidohydrolase ADH3 triple mutation | | Authors: | Dai, L.H., He, B.Y., Hu, Y.M., Xu, Y.H., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9mkb | | Status: | HPUB -- hold until publication | | Title: | Structure of the bacteriophage T4 portal-neck-tail complex | | Authors: | Fokine, A., Zhu, J., Klose, T., Vago, F., Arnaud, C., Wang, Z., Khare, B., Rossmann, M.G., Chen, Z., Sun, L., Fang, Q., Kuhn, R., Rao, V.B. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9hpt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OXA-57 | | Authors: | Shaw, J.M., Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hqf | | Status: | HPUB -- hold until publication | | Title: | SARM1 TIR domain in complex with compound 7-ADPR | | Authors: | Giroud, M., Kuhn, B., Steiner, S., Westwood, P., Mendel, M., Mani, A., Pinard, E., Haap, W., Grether, U., Caramenti, P., Rombach, D., Zambaldo, C., Ritter, M., Schmid, P., Gasser, C., Aregger, N., Sechet, N., Topp, A., Bilyard, M., Malnight-Alvarez, A., Plitzko, I., Hilbert, M., Kalayil, S., Burger, D., Bonardi, C., Saal, W., Haider, A., Wittwer, M., Brigo, A., Keaney, J., Benz, J. | | Deposition date: | 2024-12-16 | | Sequence: | >Entity 1
GGSSGSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQ
|
|
| PDBID: | 9hqh | | Status: | HPUB -- hold until publication | | Title: | SARM1 TIR domain in complex with compound 28-ADPR | | Authors: | Giroud, M., Kuhn, B., Steiner, S., Westwood, P., Mendel, M., Mani, A., Pinard, E., Haap, W., Grether, U., Caramenti, P., Rombach, D., Zambaldo, C., Ritter, M., Schmid, P., Gasser, C., Aregger, N., Sechet, N., Topp, A., Bilyard, M., Malnight-Alvarez, A., Plitzko, I., Hilbert, M., Kalayil, S., Burger, D., Bonardi, C., Saal, W., Haider, A., Wittwer, M., Brigo, A., Keaney, J., Benz, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of meropenem bound to OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of avibactam bound to OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
