| PDBID: | 9u6r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the Vo domain of V/A-ATPase in liposomes under no pmf condition,state2 | | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | | Deposition date: | 2025-03-23 |
|
| PDBID: | 9u6t | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under pmf condition, state1W | | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | | Deposition date: | 2025-03-23 |
|
| PDBID: | 9u6u | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under pmf condition, state1M | | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | | Deposition date: | 2025-03-23 |
|
| PDBID: | 9u6v | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under pmf condition, state1N | | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | | Deposition date: | 2025-03-23 |
|
| PDBID: | 9u6w | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under pmf condition, state3W | | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | | Deposition date: | 2025-03-23 |
|
| PDBID: | 9u6x | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under pmf condition, state3M | | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | | Deposition date: | 2025-03-23 |
|
| PDBID: | 9u6y | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under pmf condition, state3N | | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | | Deposition date: | 2025-03-23 |
|
| PDBID: | 9u6l | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the Vo domain of V/A-ATPase under pmf condition, State3C | | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | | Deposition date: | 2025-03-23 |
|
| PDBID: | 9u6m | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the Vo domain of V/A-ATPase under pmf condition, state3D | | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | | Deposition date: | 2025-03-23 |
|
| PDBID: | 9u6n | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under no pmf condition, state1W | | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | | Deposition date: | 2025-03-23 |
|
| PDBID: | 9u6s | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the Vo domain of V/A-ATPase in liposomes under no pmf condition,state3 | | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | | Deposition date: | 2025-03-23 |
|
| PDBID: | 9u6o | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under no pmf condition, state1M | | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | | Deposition date: | 2025-03-23 |
|
| PDBID: | 9u6p | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under no pmf condition, state1N | | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | | Deposition date: | 2025-03-23 |
|
| PDBID: | 9qmd | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Dimeric Apo-L28H-FNR of A. Fischeri | | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | | Deposition date: | 2025-03-22 |
|
| PDBID: | 9u5y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cytochrome P450 mutant-T288G S289Q G290E T291I of CYP161H12 from Amycolatopsis pretoriensis | | Authors: | Dong, L.B., Zhang, X.W., Wang, Y.X., Pan, X.M., Liu, C.H. | | Deposition date: | 2025-03-22 |
|
| PDBID: | 9qll | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of holo-D4A-FNR of A. fischeri | | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qly | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of holo-D130A-FNR of A. fischeri | | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qlt | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Dimeric Apo-D154A-FNR of A. Fischeri | | Authors: | Volbeda, A., Fontecilla-Camps, J.C. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qlz | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a [2Fe-2S] form of D4A-FNR of A. fischeri | | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qlj | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of a Disordered Apo-form of A. Fischeri FNR | | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9ql0 | | Status: | HOLD -- hold until a certain date | | Title: | E. coli IspH crystallized in the presence of adenosine hemisulfate | | Authors: | Bikbaev, K., Dormann, C., Span, I. | | Deposition date: | 2025-03-20 | | Release date: | 2026-03-20 |
|
| PDBID: | 9qkq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hTEAD4 YAP binding domain (hTEAD4-YBD) in complex with peptide 6 | | Authors: | Pozzi, C. | | Deposition date: | 2025-03-20 | | Sequence: | >Entity 1
GSHMRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
>Entity 2
(ACE)P(6CW)RLRK(NLE)PDSF(ALN)KPP(NH2)
|
|
| PDBID: | 9qld | | Status: | HPUB -- hold until publication | | Title: | Rhombohedral crystalline form of human insulin complexed with m-nitrophenol | | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | | Deposition date: | 2025-03-20 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
| PDBID: | 9u52 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | NMR Solution Structures of CX-5461-MYT1L Complex | | Authors: | Li, Y., Cao, C. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nvb | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of human SMYD1 in complex with MYH2 peptide and SAH | | Authors: | Zeng, H., Dong, A., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2025-03-20 |
|
