PDBID: | 9u6r | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the Vo domain of V/A-ATPase in liposomes under no pmf condition,state2 | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | Deposition date: | 2025-03-23 |
|
PDBID: | 9u6t | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under pmf condition, state1W | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | Deposition date: | 2025-03-23 |
|
PDBID: | 9u6u | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under pmf condition, state1M | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | Deposition date: | 2025-03-23 |
|
PDBID: | 9u6v | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under pmf condition, state1N | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | Deposition date: | 2025-03-23 |
|
PDBID: | 9u6w | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under pmf condition, state3W | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | Deposition date: | 2025-03-23 |
|
PDBID: | 9u6x | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under pmf condition, state3M | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | Deposition date: | 2025-03-23 |
|
PDBID: | 9u6y | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under pmf condition, state3N | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | Deposition date: | 2025-03-23 |
|
PDBID: | 9u6l | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the Vo domain of V/A-ATPase under pmf condition, State3C | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | Deposition date: | 2025-03-23 |
|
PDBID: | 9u6m | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the Vo domain of V/A-ATPase under pmf condition, state3D | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | Deposition date: | 2025-03-23 |
|
PDBID: | 9u6n | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under no pmf condition, state1W | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | Deposition date: | 2025-03-23 |
|
PDBID: | 9u6s | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the Vo domain of V/A-ATPase in liposomes under no pmf condition,state3 | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | Deposition date: | 2025-03-23 |
|
PDBID: | 9u6o | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under no pmf condition, state1M | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | Deposition date: | 2025-03-23 |
|
PDBID: | 9u6p | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the V1 domain of V/A-ATPase in liposomes under no pmf condition, state1N | Authors: | Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K. | Deposition date: | 2025-03-23 |
|
PDBID: | 9qmd | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Dimeric Apo-L28H-FNR of A. Fischeri | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | Deposition date: | 2025-03-22 |
|
PDBID: | 9u5y | Status: | HPUB -- hold until publication | Title: | Crystal structure of cytochrome P450 mutant-T288G S289Q G290E T291I of CYP161H12 from Amycolatopsis pretoriensis | Authors: | Dong, L.B., Zhang, X.W., Wang, Y.X., Pan, X.M., Liu, C.H. | Deposition date: | 2025-03-22 |
|
PDBID: | 9qll | Status: | HPUB -- hold until publication | Title: | Crystal structure of holo-D4A-FNR of A. fischeri | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | Deposition date: | 2025-03-21 |
|
PDBID: | 9qly | Status: | HPUB -- hold until publication | Title: | Crystal structure of holo-D130A-FNR of A. fischeri | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | Deposition date: | 2025-03-21 |
|
PDBID: | 9qlt | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Dimeric Apo-D154A-FNR of A. Fischeri | Authors: | Volbeda, A., Fontecilla-Camps, J.C. | Deposition date: | 2025-03-21 |
|
PDBID: | 9qlz | Status: | HPUB -- hold until publication | Title: | Crystal structure of a [2Fe-2S] form of D4A-FNR of A. fischeri | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | Deposition date: | 2025-03-21 |
|
PDBID: | 9qlj | Status: | HPUB -- hold until publication | Title: | Crystal Structure of a Disordered Apo-form of A. Fischeri FNR | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | Deposition date: | 2025-03-21 |
|
PDBID: | 9ql0 | Status: | HOLD -- hold until a certain date | Title: | E. coli IspH crystallized in the presence of adenosine hemisulfate | Authors: | Bikbaev, K., Dormann, C., Span, I. | Deposition date: | 2025-03-20 | Release date: | 2026-03-20 |
|
PDBID: | 9qkq | Status: | HPUB -- hold until publication | Title: | Crystal structure of hTEAD4 YAP binding domain (hTEAD4-YBD) in complex with peptide 6 | Authors: | Pozzi, C. | Deposition date: | 2025-03-20 | Sequence: | >Entity 1 GSHMRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
>Entity 2 (ACE)P(6CW)RLRK(NLE)PDSF(ALN)KPP(NH2)
|
|
PDBID: | 9qld | Status: | HPUB -- hold until publication | Title: | Rhombohedral crystalline form of human insulin complexed with m-nitrophenol | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | Deposition date: | 2025-03-20 | Sequence: | >Entity 1 GIVEQCCTSICSLYQLENYCN
>Entity 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
PDBID: | 9u52 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | NMR Solution Structures of CX-5461-MYT1L Complex | Authors: | Li, Y., Cao, C. | Deposition date: | 2025-03-20 |
|
PDBID: | 9nvb | Status: | HPUB -- hold until publication | Title: | Co-crystal structure of human SMYD1 in complex with MYH2 peptide and SAH | Authors: | Zeng, H., Dong, A., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | Deposition date: | 2025-03-20 |
|