| PDBID: | 8v5p | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the C-terminal domain of the VZV gE ectodomain in complex with the Fab of human antibody 5A2 | | Authors: | Harshbarger, W., Malito, E. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v5s | | Status: | HPUB -- hold until publication | | Title: | VZV glycoprotein E C-terminal domain (cleaved) in complex with human Fab 5A2 | | Authors: | Harshbarger, W., Malito, E. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v58 | | Status: | HPUB -- hold until publication | | Title: | Complex of murine cathepsin K with bound heparan sulfate 12mer | | Authors: | Pedersen, L.C., Xu, D., Krahn, J.M. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8x9p | | Status: | HPUB -- hold until publication | | Title: | HURP (428-534)-alpha-tubulin-beta-tubulin complex | | Authors: | Chen, P.-P., Hsia, K.-C. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v42 | | Status: | HPUB -- hold until publication | | Title: | Structure of Human Vaccinia-related Kinase 1 (VRK1) Bound to ACH000400 | | Authors: | Counago, R.M., de Souza, G.P., Azevedo, A., Guimaraes, C., Mascarello, A., Gama, F., Ferreira, M., Arruda, P. | | Deposition date: | 2023-11-28 | | Sequence: | >Entity 1
SMRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAAAAWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKAYAADPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPAANAPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRAAEIEE
|
|
| PDBID: | 8x7h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of 162 | | Authors: | Dong, C., Yan, X., Li, Y. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8x7l | | Status: | HPUB -- hold until publication | | Title: | EB-bound E46K alpha-synuclein fibrils | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8x7p | | Status: | HPUB -- hold until publication | | Title: | CCA-bound E46K alpha-synuclein fibrils | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8x7q | | Status: | HPUB -- hold until publication | | Title: | pFTAA-bound E46K alpha-synuclein fibrils | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8x7o | | Status: | HPUB -- hold until publication | | Title: | PiB-bound E46K mutanted alpha-synuclein fibrils | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8x7m | | Status: | HPUB -- hold until publication | | Title: | CR-bound E46K alpha-synuclein fibrils | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8x7g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of 108 | | Authors: | Dong, C., Yan, X., Li, Y. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8x7r | | Status: | HPUB -- hold until publication | | Title: | C05-03-bound E46K alpha-synuclein fibrils | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8x75 | | Status: | HPUB -- hold until publication | | Title: | Thy Cryo-EM Structure of Bacillus methanolicus Methanol Dehydrogenase | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8r76 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ficin C crystal form I | | Authors: | Loris, R., Baeyens-Volant, D., Azarkan, M., Kerff, F. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8r77 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Ficin C crystal form 2 | | Authors: | Loris, R., Baeyens-Volant, D., Azarkan, M., Kerff, F. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8v2v | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of recifin A [Y6F] | | Authors: | Payne, C.D., Schroeder, C.I., Rosengren, K.J. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8x7b | | Status: | PROC -- to be processed | | Title: | ThT-bound E46K mutanted alpha-synuclein fibrils | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8x6t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Peroxiredoxin I in complex with Lithospermic Acid | | Authors: | Zhang, H., Luo, C. | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8v1z | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of monoclonal antibody 1A05 in complex with BA.1 RBD | | Authors: | Bajic, G., Alesandro, C. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8x6d | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the C-terminal TBF1 | | Authors: | Gao, Y., Niu, L.W. | | Deposition date: | 2023-11-21 | | Release date: | 2024-11-21 |
|
| PDBID: | 8v16 | | Status: | HPUB -- hold until publication | | Title: | Esterase with a monomeric cooperative, hysteresis or allokairy | | Authors: | Guzzo, C.R., Vinces, T.G.C., Visnardi, A.B. | | Deposition date: | 2023-11-19 |
|
| PDBID: | 8v17 | | Status: | HPUB -- hold until publication | | Title: | HIV-CA Disulfide linked Hexamer with inhibitor bound - exploration of a benzothiazole | | Authors: | Goldstone, D.C., Walsham, L.J. | | Deposition date: | 2023-11-19 | | Sequence: | >Entity 1
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR
|
|
| PDBID: | 8x5s | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of shikimate kinase of Mycobacterium tuberculosis complex with shikimate-3-phosphate | | Authors: | Yadav, A.K., Madhuri, M., Saini, C., Inampudi, K.K., Ethayathulla, A.S., Kumar, M. | | Deposition date: | 2023-11-18 | | Release date: | 2024-11-18 |
|
| PDBID: | 8v0e | | Status: | HPUB -- hold until publication | | Title: | ANK repeat of MIB1 | | Authors: | Cao, R., Blacklow, S.C. | | Deposition date: | 2023-11-17 |
|
