Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9qot
Status:HPUB -- hold until publication
Title:APH(2'''')-IVa with an inhibitor
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C.
Deposition date:2025-03-26
PDBID:9qou
Status:HPUB -- hold until publication
Title:APH(2'''')-IVa with an inhibitor
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C.
Deposition date:2025-03-26
PDBID:9qox
Status:HPUB -- hold until publication
Title:APH(2'''')-IVa with an inhibitor
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C.
Deposition date:2025-03-26
PDBID:9qp0
Status:HPUB -- hold until publication
Title:APH(2'''')-IVa with an inhibitor
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C.
Deposition date:2025-03-26
PDBID:9nxw
Status:HPUB -- hold until publication
Title:Crystal Structure of Glutathione S-Transferase Bla g 22
Authors:Zong, G., Pedersen, L.C., Mueller, G.A.
Deposition date:2025-03-26
PDBID:9nxu
Status:HPUB -- hold until publication
Title:Crystal Structure of Glutathione S-Transferase Per a 22
Authors:Zong, G., Pedersen, L.C., Mueller, G.A.
Deposition date:2025-03-26
PDBID:9nxt
Status:HPUB -- hold until publication
Title:Crystal Structure of Glutathione S-Transferase Per a 21
Authors:Zong, G., Pedersen, L.C., Mueller, G.A.
Deposition date:2025-03-26
PDBID:9qnm
Status:HPUB -- hold until publication
Title:Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2
Authors:Useini, A., Strater, N., Kuenze, G., Sonnendecker, C.
Deposition date:2025-03-25
PDBID:9qns
Status:HPUB -- hold until publication
Title:APH(2'''')-IVa with a fragment
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C.
Deposition date:2025-03-25
PDBID:9qnn
Status:HPUB -- hold until publication
Title:APH(2'''')-IVa with a fragment
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C.
Deposition date:2025-03-25
PDBID:9qnw
Status:HPUB -- hold until publication
Title:APH(2'''')-IVa with a fragment
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C.
Deposition date:2025-03-25
Sequence:

>Entity 1


MGSSHHHHHHSSGLVPRGSHMRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSIKIK
PDBID:9qny
Status:HPUB -- hold until publication
Title:APH(2'''')-Id with a fragment
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., KowaleWski, J., Lionne, C.
Deposition date:2025-03-25
PDBID:9qnu
Status:HPUB -- hold until publication
Title:Crystal structure of Affitin C10 - fused to a coiled-coil domain - in complex with a C2 symmetric 31unit aromatic oligoamide foldamer
Authors:Sigl, J.C., Wang, L., Douat, C., Huc, I.
Deposition date:2025-03-25
PDBID:9qnq
Status:HPUB -- hold until publication
Title:APH(2'''')-Id with a fragment
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C.
Deposition date:2025-03-25
PDBID:9qnx
Status:HPUB -- hold until publication
Title:APH(2'''')-IVa with a fragment
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C.
Deposition date:2025-03-25
PDBID:9nx3
Status:HPUB -- hold until publication
Title:Crystal structure of GP232 tail fiber recognition domain from mycobacteriophage Bxz-1
Authors:Di, D., Tsai, J.H., Krieger, I.V., Sacchettini, J.C.
Deposition date:2025-03-25
PDBID:9nx4
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of a P. Aeruginosa Gyrase Chimera In Complex with 20mer DNA and Ciprofloxacin
Authors:Pedersen, L.C., Doetsch, P.W., Garcia-Villada, L., Degtyareva, N., Perera, U.L.
Deposition date:2025-03-25
PDBID:9nx5
Status:HPUB -- hold until publication
Title:Crystal Structure of a P. Aeruginosa Gyrase
Authors:Pedersen, L.C., Doetsch, P.W., Garcia-Villada, L., Degtyareva, N., Perera, U.L.
Deposition date:2025-03-25
PDBID:9qms
Status:WAIT -- processing started, waiting for author input to continue processing
Title:DNA-PK bound to 153 bp H2AX nucleosome with ATPyS
Authors:Hall, C., Chaplin, A.K.
Deposition date:2025-03-24
PDBID:9qmr
Status:HPUB -- hold until publication
Title:APH(2'''')-Id with a fragment
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C.
Deposition date:2025-03-24
PDBID:9qn6
Status:AUTH -- processed, waiting for author review and approval
Title:APH(2'''')-IVa with a fragment
Authors:Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C.
Deposition date:2025-03-24
PDBID:9qn5
Status:HPUB -- hold until publication
Title:Crystal structure of human SUMO E1 with small unit cell parameters in the P1 21 1 space group.
Authors:Viloria, M., Francois, R.M.M., Didierjean, C.
Deposition date:2025-03-24
PDBID:9nww
Status:AUTH -- processed, waiting for author review and approval
Title:Single-particle cryo-EM structure of the first variant of mobilized colistin resistance (MCR-1) in its ligand-bound state
Authors:Zinkle, A.P., Bunuro-Batista, M., Herrera, C.M., Erramilli, S.K., Kloss, B., Ashraf, K.U., Nosol, K., Zhang, G., Cater, R.J., Marty, M.T., Kossiakoff, A.A., Trent, M.S., Nygaard, R., Stansfeld, P.J., Mancia, F.
Deposition date:2025-03-24
PDBID:7i92
Status:HPUB -- hold until publication
Title:Crystal Structure of 9 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i93
Status:HPUB -- hold until publication
Title:Crystal Structure of 27 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24

242842

PDB entries from 2025-10-08

PDB statisticsPDBj update infoContact PDBjnumon