PDBID: | 9fpw | Status: | HPUB -- hold until publication | Title: | Crystal structure of carbonic anhydrase XIII with methyl 4-(2-phenylethylsulfanyl)-3-sulfamoyl-benzoate | Authors: | Smirnov, A., Manakova, E.N., Grazulis, S., Paketuryte, V. | Deposition date: | 2024-06-13 | Sequence: | >Entity 1 MMSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
|
|
PDBID: | 8zwf | Status: | AUTH -- processed, waiting for author review and approval | Title: | cryoEM structure of JR14a bound C3aR-BRIL-BAG2 complex | Authors: | Luo, P., Xu, Y., Xu, H.E. | Deposition date: | 2024-06-13 |
|
PDBID: | 8zwg | Status: | AUTH -- processed, waiting for author review and approval | Title: | cryoEM structure of JR14a bound C3aR-Gi complex | Authors: | Luo, P., Xu, Y., Xu, H.E. | Deposition date: | 2024-06-13 |
|
PDBID: | 8zx1 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of E.Coli membrane protein | Authors: | Qiao, Z., Gao, Y.G. | Deposition date: | 2024-06-13 |
|
PDBID: | 9c91 | Status: | HPUB -- hold until publication | Title: | Assimilatory NADPH-dependent sulfite reductase minimal dimer | Authors: | Ghazi Esfahani, B., Walia, N., Neselu, K., Aragon, M., Askenasy, I., Wei, A., Mendez, J.H., Stroupe, M.E. | Deposition date: | 2024-06-13 |
|
PDBID: | 9foj | Status: | AUTH -- processed, waiting for author review and approval | Title: | LGTV TP21. Langat virus, strain TP21 | Authors: | Bisikalo, K., Rosendal, E. | Deposition date: | 2024-06-12 |
|
PDBID: | 9fp2 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the BcsEFRQ regulatory subcomplex for E. coli cellulose secretion in non-saturating c-di-GMP (local) | Authors: | Anso, I., Krasteva, P.V. | Deposition date: | 2024-06-12 | Release date: | 2024-08-07 |
|
PDBID: | 9c8k | Status: | AUTH -- processed, waiting for author review and approval | Title: | Rabbit Hemorrhagic Disease Virus reinitiation stimulating TURBS RNA bound to rabbit ribosome | Authors: | Sherlock, M.E., Kieft, J.S. | Deposition date: | 2024-06-12 |
|
PDBID: | 9c86 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of endogenous asymmetric DPYSL2 from rat model of Alzheimer''s disease | Authors: | Khalili Samani, E., Keszei, A.F.A., Mazhab-Jafari, M.T. | Deposition date: | 2024-06-12 |
|
PDBID: | 9c8d | Status: | PROC -- to be processed | Title: | mouse Seipin/Adig complex | Authors: | Li, C., Han, Y., Wynn, R.M., Chen, Z., Scherer, P.E. | Deposition date: | 2024-06-12 |
|
PDBID: | 9c8e | Status: | PROC -- to be processed | Title: | mouse Seipin complex | Authors: | Li, C., Han, Y., Wynn, R.M., Chen, Z., Scherer, P.E. | Deposition date: | 2024-06-12 |
|
PDBID: | 9c8q | Status: | AUTH -- processed, waiting for author review and approval | Title: | Co-structure of Main Protease of SARS-CoV-2 (COVID-19) with covalent inhibitor | Authors: | Knapp, M.S., Ornelas, E. | Deposition date: | 2024-06-12 |
|
PDBID: | 9c7s | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo EM structure of SARS-COV-2 (BQ 1.1) RBD in complex with Fab COV2-3891 (local refine) | Authors: | Binshtein, E., Crowe, J.E. | Deposition date: | 2024-06-11 |
|
PDBID: | 9fob | Status: | AUTH -- processed, waiting for author review and approval | Title: | Glyceraldehyde 3-phosphate Dehydrogenase (GapA) from Helicobacter pylori in Complex with NAPD (Holo) | Authors: | Elliott, P.R., Moody, P.C.E. | Deposition date: | 2024-06-11 |
|
PDBID: | 9fod | Status: | AUTH -- processed, waiting for author review and approval | Title: | Glyceraldehyde 3-phosphate dehydrogenase A (GAPDHA) apoenzyme, from Helicobacter pylori | Authors: | Foster, S.P., Moody, P.C.E. | Deposition date: | 2024-06-11 |
|
PDBID: | 8zva | Status: | AUTH -- processed, waiting for author review and approval | Title: | structure of ShosA from E.coli APEC O1 | Authors: | Yu, Y., Chen, Q., Pu, H. | Deposition date: | 2024-06-11 |
|
PDBID: | 9c7o | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of the Maize R ACT-like Domain | Authors: | Silwal, J., Ghanbarpour, A., Lee, Y.S., Geiger, J.H., Grotewold, E. | Deposition date: | 2024-06-10 |
|
PDBID: | 9c7n | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of the GL3 ACT-like Domain | Authors: | Ghanbarpour, A., Lee, Y.S., Silwal, J., Geiger, J.H., Grotewold, E. | Deposition date: | 2024-06-10 |
|
PDBID: | 9c6t | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the Human ISM1 TSR-AMOP domains | Authors: | Stayrook, S., Li, T., Klein, D.E. | Deposition date: | 2024-06-08 |
|
PDBID: | 9c6d | Status: | PROC -- to be processed | Title: | Crystal structure of mutant NonPro1 Tautomerase Superfamily Member 8U6-S1P in complex with 3-bromopropiolate inhibitor | Authors: | Lancaster, E.B., Hardtke, H.A., Melkonian, T.R., Venkat Ramani, M.K., Johnson Jr., W.H., Baas, B.J., Zhang, Y.J., Whitman, C.P. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c66 | Status: | HPUB -- hold until publication | Title: | Structure of the Mena EVH1 domain bound to the polyproline segment of PTP1B | Authors: | LaComb, L., Fedorov, E., Bonanno, J.B., Almo, S.C., Ghosh, A. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c5x | Status: | AUTH -- processed, waiting for author review and approval | Title: | Molecular basis for HerA-Duf supramolecular complex in anti-phage defense - Assembly 3 | Authors: | Rish, A.D., Fu, T.M., Fosuah, E. | Deposition date: | 2024-06-06 |
|
PDBID: | 8zt8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of calcium preference channel P2X1 | Authors: | Zhang, H., Xu, H.E. | Deposition date: | 2024-06-06 | Release date: | 2025-06-06 |
|
PDBID: | 9fm8 | Status: | HPUB -- hold until publication | Title: | Imine Reductase from Rhodococcus erythropolis | Authors: | Domenech, J., Jongkind, E.P.J., Paul, C.E., Grogan, G. | Deposition date: | 2024-06-05 |
|
PDBID: | 9fm7 | Status: | HPUB -- hold until publication | Title: | Imine Reductase from Rhodococcus erythropolis | Authors: | Domenech, J., Jongkind, E.P.J., Paul, C.E., Grogan, G. | Deposition date: | 2024-06-05 |
|