Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:8rse
Status:HPUB -- hold until publication
Title:Proteinase K measured via serial crystallography from a silicon HARE-chip
Authors:Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C.
Deposition date:2024-01-24
PDBID:8rsf
Status:HPUB -- hold until publication
Title:Proteinase K measured via serial crystallography from a kapton HARE-chip (50 micron)
Authors:Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C.
Deposition date:2024-01-24
PDBID:8rmh
Status:HPUB -- hold until publication
Title:Crystal structure of parallel G-quadruplex containing T-tetrads and TG-octaplet
Authors:Abdullrahman, A., El Omari, K., Paterson, N., Orr, C., Lambert, M., Cardin, C.J., Sanchez-Weatherby, J., Hall, J.P.
Deposition date:2024-01-06
PDBID:8vhs
Status:AUTH -- processed, waiting for author review and approval
Title:X-ray Structure of a De Novo Designed Self Assembled Peptide Tetramer Featuring a Cu(His)4(H2O) Coordination Motif
Authors:Chakraborty, S., Mitra, S., Prakash, D., Prasad, P.
Deposition date:2024-01-02
PDBID:8ric
Status:HPUB -- hold until publication
Title:Crystallographic structure of oligosaccharide dehydrogenase from Pycnoporus cinnabarinus bound to Sinapic Acid, tetragonal crystal
Authors:Savino, C., Sciara, G., Gugole, E., Vallone, B., Fata, F., Bulfaro, G., Costanzo, A., Montemiglio, L.C.
Deposition date:2023-12-18
PDBID:8rhd
Status:HPUB -- hold until publication
Title:Crystal structure of Neisseria gonorrhoeae FabI in complex with NADH and (E)-3-((2R,3S)-3-hydroxy-2-methyl-4-oxo-2,3,4,5-tetrahydro-1H-pyrido[2,3-b][1,4]diazepin-8-yl)-N-methyl-N-((3-methylbenzofuran-2-yl)methyl)acrylamide
Authors:Ronin, C., Gerusz, V., Ciesielski, F.
Deposition date:2023-12-15
PDBID:8reg
Status:HPUB -- hold until publication
Title:Lysozyme measured via serial crystallography from a kapton HARE-chip (50 micron)
Authors:Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C.
Deposition date:2023-12-11
PDBID:8reh
Status:HPUB -- hold until publication
Title:Lysozyme measured via serial crystallography from a kapton HARE-chip (125 micron)
Authors:Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C.
Deposition date:2023-12-11
PDBID:8rei
Status:HPUB -- hold until publication
Title:CTX-M-14 measured via serial crystallography from a silicon HARE-chip.
Authors:Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C.
Deposition date:2023-12-11
PDBID:8rem
Status:HPUB -- hold until publication
Title:CTX-M-14 measured via serial crystallography from a kapton HARE-chip (50 micron)
Authors:Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C.
Deposition date:2023-12-11
PDBID:8uda
Status:HPUB -- hold until publication
Title:Crystal Structure of Mu class Glutathione-S-Transferase, TuGSTm12(Tetur05g05300) from Tetranychus urticae
Authors:Khatri, K., Arriaza, R.H., Chruszcz, M.
Deposition date:2023-09-28
PDBID:8udb
Status:HPUB -- hold until publication
Title:Crystal Structure of Mu class GST from TuGSTm12 (Tetur05g05300) from Tetranychus urticae
Authors:Khatri, K., Arriaza, R., Chruszcz, M.
Deposition date:2023-09-28
PDBID:8udd
Status:HPUB -- hold until publication
Title:Crystal Structure of Mu class Glutathione-S-Transferase, TuGSTm12(Tetur05g05300) from Tetranychus urticae
Authors:Khatri, K., Arriaza, R.H., Chruszcz, M.
Deposition date:2023-09-28
PDBID:8ude
Status:HPUB -- hold until publication
Title:Crystal Structure of Mu class Glutathione-S-Transferase, TuGSTm06(Tetur05g05220) from Tetranychus urticae
Authors:Khatri, K., Arriaza, R.H., Chruszcz, M.
Deposition date:2023-09-28
PDBID:8udh
Status:HPUB -- hold until publication
Title:Crystal Structure of Mu class Glutathione-S-Transferase TuGSTm06(Tetur05g05220) in complex with reaction product
Authors:Khatri, K., Arriaza, R.H., Chruszcz, M.
Deposition date:2023-09-28
PDBID:8qht
Status:HPUB -- hold until publication
Title:Leishmania braziliensis PRMT1-PRMT3 heterotetrameric complex in unliganded form.
Authors:Levdikov, V., Nay, E., Walrad, P., Plevin, J.M.
Deposition date:2023-09-10
Release date:2025-03-10
Sequence:

>Entity 1


DYYFDSYSHYGIHMEMLKDYHRTTTYRDAIWRNAYMFKDKVVLDVGCGTGILSMFAARAGARKVIGIDCSNVAVQARQIVQDNGFSDIITIIQGKVEELDLDEKVDIIISEWMGYFLLYESMLNTVLYARDRWGASDVKILPSSANMYACGITDPQYVEQKFNIWNSVNGLDFSYFKRLSYIEPLIDTVNPEQIITDIVPFFSFDINRVTEAELSFTSTFTLEAKQGDFVHAISVHFDTPFYAGHDPVVLNTSPMVPPTHWRQTVLYMFHPLIMKRGEKANFTMKCAPNPGNPRDLDISLHIDFDGELQACHYDQDFRLR

>Entity 2


SAARISSNISTIHDHQRLRAYEVIFRNVRGKTLLHLGCGMGLYSMLAARGMAKMVIGIDSSAIVDAARVVAEQNGLKNIQFIRGRLCEALHQLPSDMKFDYVLCEWMGPLLLNERVLTDALYARDHLLTESGALCPNRASLHVVAVSDYAFRLDTEDFWSNVYGFQMEPMKELVRQEVEMCAIPGSNIVSAPCLAHTIHMDTLEGLTAEETATYEAQANQAAAIRDNEEENPVEHCWVPAAVAQKGYEAAFTLSIARSATVHYLTFYLDAAFTSKTNPGANFVLAVRPGGQNNWTEVSVGLREPLPVNAGEKIQGTVRVYTPAEKGGKVTVVEVTAKTAGQVAAIETFGTYYYQSY
PDBID:2m4a
Status:POLC -- waiting for a policy decision
Title:NMR data-driven model of GTPase Rheb-GDP tethered to a lipid-bilayer nanodisc
Authors:Mazhab-Jafari, M.T., Stathopulos, P.B., Marshall, C.B., Kobashigawa, Y., Stambolic, V., Kay, L.E., Inagaki, F., Ikura, M.
Deposition date:2013-02-03
PDBID:2m4b
Status:POLC -- waiting for a policy decision
Title:NMR data-driven model of GTPase Rheb-GTP tethered to a lipid-bilayer nanodisc
Authors:Mazhab-Jafari, M.T., Stathopulos, P.B., Marshall, C.B., Kobashigawa, Y., Stambolic, V., Kay, L.E., Inagaki, F., Ikura, M.
Deposition date:2013-02-03
PDBID:3ujx
Status:POLC -- waiting for a policy decision
Title:Solution structures of tetrameric mannose-binding lectin
Authors:Miller, A., Phillips, A., Wallis, R., Perkins, S.J.
Deposition date:2011-11-08
<1234

 

226262

PDB entries from 2024-10-16

PDB statisticsPDBj update infoContact PDBjnumon