| PDBID: | 9m9e | | Status: | HPUB -- hold until publication | | Title: | Structural Basis of Pausing During Transcription Initiation in Mycobacterium tuberculosis | | Authors: | Zheng, L.T. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 9qei | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF LYSYL-TRNA SYNTHETASE FROM Mycobacterium tuberculosis COMPLEXED WITH L-LYSINE AND INHIBITOR DDD01866774 | | Authors: | Dawson, A., Cleghorn, L.A.T., Davis, S.H. | | Deposition date: | 2025-03-10 |
|
| PDBID: | 9m7a | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Serine Acetyltransferase (SAT) from Planctomyces limnophilus in complex with its inhibitor (Cysteine) | | Authors: | Kumar, N., Kumaran, S. | | Deposition date: | 2025-03-10 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMATDLRLKDQLPEITDRIVESYRDFATTHHLGHCPLPSSEAVYEIAQDLQEILFPGYRRRQNLHMGNVTYHVGDLVDSLHDRLTQQIARALRHDYRRQHGISCADEVSHDFEALAQAKTITLLELLPRLRRTLALDVQAAFDGDPAAGSLDEIIFCYPGLHAVTIYRLAHELYLLDVPLIPRMLTEWAHSQTGIDIHPGATIGHSFFIDHGTGVVIGETCEIANHVKLYQGVTLGALSFPKDEQGNLLRRHKRHPTIEDHVVIYANATVLGGETVIGSHAVIGSSVSLSHSVPPNTIVTIEKPSLRYREAS
|
|
| PDBID: | 9qef | | Status: | HPUB -- hold until publication | | Title: | Respiratory supercomplex from Mycobacterium smegmatis with decylubiquinone | | Authors: | Kovalova, T., Krol, S., Brzezinski, P., Hogbom, M. | | Deposition date: | 2025-03-09 |
|
| PDBID: | 9qea | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF LYSYL-TRNA SYNTHETASE FROM Mycobacterium tuberculosis COMPLEXED WITH L-LYSINE AND INHIBITOR DDD01839469 | | Authors: | Dawson, A., Cleghorn, L.A.T., Davis, S.H. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9qdj | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF LYSYL-TRNA SYNTHETASE FROM Mycobacterium tuberculosis COMPLEXED WITH L-LYSINE AND INHIBITOR DDD018870911 | | Authors: | Dawson, A., Cleghorn, L.A.T., Davis, S.H. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9qc3 | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF LYSYL-TRNA SYNTHETASE FROM Mycobacterium tuberculosis COMPLEXED WITH L-LYSINE AND INHIBITOR DDD01993593 | | Authors: | Dawson, A., Cleghorn, L.A.T., Davis, S.H. | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9qc4 | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF LYSYL-TRNA SYNTHETASE FROM Mycobacterium tuberculosis COMPLEXED WITH L-LYSINE AND INHIBITOR DDD01869767 | | Authors: | Dawson, A., Cleghorn, L.A.T., Davis, S.H. | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9qbr | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF LYSYL-TRNA SYNTHETASE FROM Mycobacterium tuberculosis COMPLEXED WITH L-LYSINE AND INHIBITOR DDD01991231 | | Authors: | Dawson, A., Cleghorn, L.A.T., Davis, S.H. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 9m25 | | Status: | HOLD -- hold until a certain date | | Title: | Type I diterpene synthase from Streptomyces | | Authors: | Bai, Z.Y., Ma, M. | | Deposition date: | 2025-02-27 | | Release date: | 2026-02-27 |
|
| PDBID: | 9m1v | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of N-terminal domain of hypothetical protein Rv1421 from Mycobacterium tuberculosis H37Rv in complex with uridine diphosphate N-acetyl glucosamine | | Authors: | Lee, K.S., Park, J. | | Deposition date: | 2025-02-26 | | Release date: | 2025-08-26 | | Sequence: | >Entity 1
MMNHARGVENRSEGGGIDVVLVTGLSGAGRGTAAKVLEDLGWYVADNLPPQLITRMVDFGLAAGSRITQLAVVMDVRSRGFTGDLDSVRNELATRAITPRVVFMEASDDTLVRRYEQNRRSHPLQGEQTLAEGIAAERRMLAPVRATADLIIDTSTLSVGGLRDSIERAFGGDG
|
|
| PDBID: | 9m1f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli tryptophanyl-tRNA synthetase complexed with chuangxinmycin and ATP in closed-closed state | | Authors: | Ren, Y., Wang, S., Liu, W., Fang, P. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9m1g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli tryptophanyl-tRNA synthetase complexed with chuangxinmycin and ATP in open-closed state | | Authors: | Ren, Y., Wang, S., Liu, W., Fang, P. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9lvn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phospholipase D SkPLD (Streptomyces klenkii) | | Authors: | Hu, R.K., Feng, C.H. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ltx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a polyketide decarboxylase Abx(+)O from Actinomycetes sp. MA7150 | | Authors: | Luo, S., Zhu, C., Jiang, K., Qu, X. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9lt9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Gle1 from Debaryomyces hansenii | | Authors: | Jang, M.J., Chang, J.H. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i4q | | Status: | HPUB -- hold until publication | | Title: | SSX structure of dye-type peroxidase DtpB from Streptomyces lividans | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9n0p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo EM structure of the Open tetramer from Mycobacterium Tuberculosis. | | Authors: | Gupta, J., Izard, T. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9lp6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phenolic acid decarboxylase Mav Pad (Mycobacterium avium) | | Authors: | Wu, B., Yu, L., Wang, Y.H. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9mz5 | | Status: | HPUB -- hold until publication | | Title: | EatA-EatI complex from Mycobacterium avium subsp. paratuberculosis | | Authors: | Benedict, S.T., Moynihan, P.J. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9myt | | Status: | HPUB -- hold until publication | | Title: | EatA-EatI complex from Mycobacterium abscessus | | Authors: | Benedict, S.T., Moynihan, P.J. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9myc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9lmm | | Status: | HPUB -- hold until publication | | Title: | An antibiotic biosynthesis monooxygenase family protein from Streptomyces sp. MA37 | | Authors: | Jiang, K., Qu, X.D. | | Deposition date: | 2025-01-19 |
|
| PDBID: | 9mx0 | | Status: | HPUB -- hold until publication | | Title: | Cluster of bipartite complex of MmpL5-AcpM from Mycolicibacterium smegmatis | | Authors: | Zhang, Z., Maharjan, R., Gregor, W. | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9i22 | | Status: | HPUB -- hold until publication | | Title: | Structure of Human helicase RecQ1- Myc G-quadruplex - ADP complex | | Authors: | Song, Z.Y., Liu, N.N., Ai, X., Rety, S., Xi, X.G. | | Deposition date: | 2025-01-17 |
|
