| PDBID: | 8x5s | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of shikimate kinase of Mycobacterium tuberculosis complex with shikimate-3-phosphate | | Authors: | Yadav, A.K., Madhuri, M., Saini, C., Inampudi, K.K., Ethayathulla, A.S., Kumar, M. | | Deposition date: | 2023-11-18 | | Release date: | 2024-11-18 |
|
| PDBID: | 8v0d | | Status: | HPUB -- hold until publication | | Title: | Ubch5B-RING3 of MIB1 fusion structure | | Authors: | Cao, R., Blacklow, S.C. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8v0e | | Status: | HPUB -- hold until publication | | Title: | ANK repeat of MIB1 | | Authors: | Cao, R., Blacklow, S.C. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8x48 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (EGTA) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x4c | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (20 uM Ca2+, 2 mM ATP) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8r4n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of neutralizing Fab Eq4.Dp46-3A from equine antivenom bound to short chain three finger alpha-neurotoxin from Dendroaspis polylepis. | | Authors: | Wibmer, C.K. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8r4l | | Status: | HPUB -- hold until publication | | Title: | CSP1 M48L mutant without Iodide | | Authors: | Basle, A., David, S., Dennison, C. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8r4m | | Status: | HPUB -- hold until publication | | Title: | CSP1 M48L mutant without Iodide | | Authors: | Basle, A., David, S., Dennison, C. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8uyu | | Status: | HPUB -- hold until publication | | Title: | HBV T=4 capsid from HEK-293T cells | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
|
|
| PDBID: | 8uyv | | Status: | HPUB -- hold until publication | | Title: | HBV T=4 3A mutant capsid from HEK-293T cells | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRAPRRRTPAPRRRRSQAPRRRRSQSREPQC
|
|
| PDBID: | 8uyw | | Status: | HPUB -- hold until publication | | Title: | HBV T=3 3A mutant capsid from HEK-293T cells | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRAPRRRTPAPRRRRSQAPRRRRSQSREPQC
|
|
| PDBID: | 8uyx | | Status: | HPUB -- hold until publication | | Title: | HBV Cp149 capsid protein (Wild-type control) | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTL
|
|
| PDBID: | 8uyy | | Status: | HPUB -- hold until publication | | Title: | HBV Cp149 capsid protein (Preassembled capsid incubated with triton X-100) | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
|
|
| PDBID: | 8uyz | | Status: | HPUB -- hold until publication | | Title: | HBV Cp149 capsid protein (HBV dimer co-assembled with triton X-100) | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
|
|
| PDBID: | 8uyr | | Status: | HPUB -- hold until publication | | Title: | Manganese-substituted DitZ from Rhodococcus Rhodochrous | | Authors: | Liu, C., Chen, S., Rittle, J. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8uyt | | Status: | HPUB -- hold until publication | | Title: | HBV T=4 capsid from HEK-293T cells | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRG
|
|
| PDBID: | 8uyq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Consensus olfactory receptor consOR4 bound to 2-methylthiazoline and in complex with mini-Gs trimeric protein | | Authors: | Billesboelle, C.B., Del Torrent, C.L., Manglik, A. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uy5 | | Status: | HPUB -- hold until publication | | Title: | [ZP] Self-assembling DNA crystal with expanded genetic code using C,A,T,G, Z and P nucleotides | | Authors: | Vecchioni, S., Sha, R., Ohayon, Y.P., Hernandez, C. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uy3 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Fem1B with FNIP1 and Tom20 fragment | | Authors: | Gee, C.L., Manford, A.G., McMinimy, R., Rape, M. | | Deposition date: | 2023-11-12 | | Release date: | 2024-11-12 |
|
| PDBID: | 8uxy | | Status: | HPUB -- hold until publication | | Title: | Consensus olfactory receptor consOR1 bound to L-menthol and in complex with mini-Gs trimeric protein | | Authors: | Billesboelle, C.B., Del Torrent, C.L., Manglik, A. | | Deposition date: | 2023-11-11 |
|
| PDBID: | 8r3h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Phalloidin bound F-actin | | Authors: | Yuan, B., Paraschiakos, T., Windhorst, S., Marlovits, T.C. | | Deposition date: | 2023-11-09 | | Release date: | 2024-11-09 |
|
| PDBID: | 8r3j | | Status: | HOLD -- hold until a certain date | | Title: | F-actin decorated by ITPKA | | Authors: | Yuan, B., Paraschiakos, T., Windhorst, S., Marlovits, T.C. | | Deposition date: | 2023-11-09 | | Release date: | 2024-11-09 |
|
| PDBID: | 8uxo | | Status: | HPUB -- hold until publication | | Title: | Caulobacter crescentus FljK flagellar filament (symmetrized) | | Authors: | Sanchez, J.C., Montemayor, E.J., Ploscariu, N.T., Parrell, D., Baumgardt, J.K., Yang, J.E., Sibert, B., Cai, K., Wright, E.R. | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8uxa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Glucose treated mitochondrial ribosome of saccharomyces cerevisiae class I | | Authors: | Yu, Z., Zheng, F., Zhou, C. | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8ux4 | | Status: | HPUB -- hold until publication | | Title: | Mitochondrial ribosome of saccharomyces cerevisiae class II from YEP with Dextrose culture | | Authors: | Yu, Z., Zheng, F., Zhou, C. | | Deposition date: | 2023-11-08 |
|
