| PDBID: | 8rsf | | Status: | HPUB -- hold until publication | | Title: | Proteinase K measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8vso | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3 sigma, BRAF phosphopeptide (pS365) and compound 78 (1124378) | | Authors: | Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8vsl | | Status: | HPUB -- hold until publication | | Title: | Binary structure of 14-3-3 sigma and ARAF phosphopeptide (pS214) | | Authors: | Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8vsm | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3 sigma, ARAF phosphopeptide (pS214) and compound 78 (1124378) | | Authors: | Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8vsn | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3 sigma, ARAF phosphopeptide (pS214) and compound 79 (1124379) | | Authors: | Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8rrt | | Status: | HPUB -- hold until publication | | Title: | Structure of rabbit RyR1 reconstituted into lipid liposomes in open state in complex with FKBP and Nb9657 | | Authors: | Li, C., Efremov, R.G. | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8rrs | | Status: | HPUB -- hold until publication | | Title: | Structure of mouse RyR2 solubilised in detergent in open state in complex with Ca2+, ATP, caffeine and Nb9657. | | Authors: | Li, C., Efremov, R.G. | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vrp | | Status: | HPUB -- hold until publication | | Title: | HIV-CA Disulfide linked Hexamer bound to 4-Quinazolinone Scaffold inhibitor | | Authors: | Goldstone, D.C., Walsham, L. | | Deposition date: | 2024-01-22 | | Sequence: | >Entity 1
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR
|
|
| PDBID: | 8xza | | Status: | HPUB -- hold until publication | | Title: | BA.2.86 Spike in complex with bovine ACE2 (Local refinement) | | Authors: | Yue, C., Liu, P. | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xz9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BA.2.86 Spike in complex with bovine ACE2 (bound 2 ACE2) | | Authors: | Yue, C., Liu, P. | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xz8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BA.2.86 Spike in complex with bovine ACE2 (bound 1 ACE2) | | Authors: | Yue, C., Liu, P. | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xy9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 BF.7 RBD and human ACE2 complex | | Authors: | Lan, J., Wang, C.H. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8xye | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 BA.4 RBD and human ACE2 | | Authors: | Lan, J., Wang, C.H. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8xyg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 BQ.1.1 RBD and human ACE2 | | Authors: | Lan, J., Wang, C.H. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8vqv | | Status: | HPUB -- hold until publication | | Title: | Structure of S. odontolytica ZTP riboswitch bound to m-1-pyridinyl-AICA | | Authors: | Jones, C.P., Ferre D''Amare, A.R. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8vqo | | Status: | HPUB -- hold until publication | | Title: | A novel fold revealed by ex-vivo PrPSc from Elk infected with CWD | | Authors: | Banerjee, V., Wang, F., Baker, M.L., Serysheva, I.I., Soto, C. | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8vqf | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of natural Can f 1 in complex with human IgE 1J11 Fab | | Authors: | Khatri, K., Ball, A., Richardson, C.M., Smith, S.A., Champan, M.D., Pomes, A., Chruszcz, M. | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8vqg | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of Can f 1 | | Authors: | Khatri, K., Geoffrey, M.A., Pedersen, L.C., Champan, M.D., Pomes, A., Chruszcz, M. | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8xwy | | Status: | HPUB -- hold until publication | | Title: | Structure of Interleukin-27 | | Authors: | Feng, Y., Dong, X.C. | | Deposition date: | 2024-01-17 |
|
| PDBID: | 8xx2 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human Peroxiredoxin I in Complex with SAB | | Authors: | Xu, H., Zhang, H., Luo, C. | | Deposition date: | 2024-01-17 |
|
| PDBID: | 8xww | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the catalytic domain of human PDE5A complexed with 2-(3-chlorobenzyl)-4-oxo-3,4-dihydroquinazoline-7-carboxylic acid | | Authors: | Zhang, F.C., Huang, Y.Y., Luo, H.B., Wu, Y.Y. | | Deposition date: | 2024-01-16 |
|
| PDBID: | 8xwd | | Status: | HOLD -- hold until a certain date | | Title: | Croy-EM structure of alpha synuclein fibril with EGCG | | Authors: | Li, X., Liu, C. | | Deposition date: | 2024-01-16 | | Release date: | 2025-01-16 |
|
| PDBID: | 8xwo | | Status: | HOLD -- hold until a certain date | | Title: | Vibrio harveyi chitoporin in complex with minocycline | | Authors: | Sanram, S., Suginta, W., Robinson, R.C. | | Deposition date: | 2024-01-16 | | Release date: | 2025-01-16 |
|
| PDBID: | 8vpm | | Status: | HPUB -- hold until publication | | Title: | Glutaminyl cyclase ApgG, rod shape | | Authors: | Nie, Q., Chang, C., Gao, Y., Gao, X. | | Deposition date: | 2024-01-16 |
|
| PDBID: | 8vor | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC) containing mRNA with a 51 nt long spacer, NusG, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | | Deposition date: | 2024-01-15 |
|
