| PDBID: | 9qvs | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the CtaG_D144N variant from Ruminiclostridium cellulolyticum (P2(1)-small) | | Authors: | Gude, F., Bohne, A., Dell, M., Franke, J., Dunbar, K.L., Groll, M., Hertweck, C. | | Deposition date: | 2025-04-11 | | Release date: | 2026-04-11 | | Sequence: | >Entity 1
GSHMASMLLDTFQGYNCYSSALGEYAKQKNIDQVENIILSQWSFFFDEEQFYKNQWYTGAADGPVDVVLNEDLRNFANIEVLEHISSESQAIDEGRKVLEKHGLQIVLMDFYYMNSFNWKSLSRFNVTREHDPHFAVLTQINENSVHIINPYYHHEENMSMEDFIKSRNSMTKQGKISFNSYEIFSNGTKKSNIKELLYYRFNRYLQEKMFGKITQFGQVVKKQLDNKDRKWAFTGYNCLNSVVYQHQNLINLQKKFSLEMPPNLQELLDNWALIRKKLFEYYSRGSYNTEEISNLICKVASSEEQFAQEVLKVL
|
|
| PDBID: | 9ufo | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the asymmetrically reconstructed phage T4 capsid-neck-tail complex | | Authors: | Shao, Q., Dong, J., Wang, A., Li, L., Zheng, Y., Li, H., Li, Y., Zhang, Q., Sun, L., Fokine, A., Rao, V.B., Tao, P., Fang, Q. | | Deposition date: | 2025-04-10 | | Release date: | 2026-04-10 |
|
| PDBID: | 9ufi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a PhGs rhamnosyltransferase UGT79G15 from Rehmannia glutinosa in complex with UDP and FSA | | Authors: | Wei, H.L., Liu, W.D., Zhuang, Y.B., Liu, T. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ufc | | Status: | HOLD -- hold until a certain date | | Title: | Structural of a glutamate cysteine ligase StGSH1 in Solanum tuberosum | | Authors: | Zhao, H.B., Fan, S.L. | | Deposition date: | 2025-04-10 | | Release date: | 2026-04-10 |
|
| PDBID: | 9ufa | | Status: | HOLD -- hold until a certain date | | Title: | phosphatidylcholine head group bound alpha-hemolysin heptameric pore structure in the presence of RBC | | Authors: | Dutta, S., Chatterjee, A., Roy, A. | | Deposition date: | 2025-04-10 | | Release date: | 2025-10-10 |
|
| PDBID: | 9ufg | | Status: | HPUB -- hold until publication | | Title: | Structure of a triple-helix region of human collagen type XII | | Authors: | Zhu, Y., Yang, X., Sun, F. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9uf7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a PhGs rhamnosyltransferase UGT79G15 from Rehmannia glutinosa in complex with UDP | | Authors: | Wei, H.L., Liu, W.D., Zhuang, Y.B., Liu, T. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9o5d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The KICSTOR-GATOR1-SAMTOR complex | | Authors: | Bayly-Jones, C., Lupton, C.J., Chang, Y.G., Ellisdon, A.M. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9o5e | | Status: | HPUB -- hold until publication | | Title: | The dimeric KICSTOR-GATOR1 supercomplex | | Authors: | Bayly-Jones, C., Lupton, C.J., Chang, Y.G., Ellisdon, A.M. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9o5g | | Status: | HPUB -- hold until publication | | Title: | Room-temperature joint X-ray/Neutron structure of Thermus thermophilus SHMT in complex with PLP-Gly external aldimine and 5-methyl-tetrahydrofolate (5MTHF) | | Authors: | Kovalevsky, A., Drago, V.N., Phillips, R.S. | | Deposition date: | 2025-04-10 | | Sequence: | >Entity 1
STLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTHKTLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPMP
|
|
| PDBID: | 9o5r | | Status: | HPUB -- hold until publication | | Title: | VAR2CSA in complex with V2C.044 Fab | | Authors: | Raghavan, S.S.R., Ward, A.B. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9quf | | Status: | HPUB -- hold until publication | | Title: | Structure of a fungal Ube2O | | Authors: | Kordic, D., Williams, T.L., Luiza Deszcz, L., Ehrmann, J., Arnese, R., Meinhart, A., Clausen, T. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9qu8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | apPol-DNA-nucleotide complex (ternary2) | | Authors: | Lahiri, I., Kumari, A. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9que | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of human MTH1 in complex with 8DG by continuous serial electron diffraction (SerialED) | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9qud | | Status: | HPUB -- hold until publication | | Title: | Cu(II)-bound de novo protein scaffold TFD-EH | | Authors: | Wagner Egea, P., Delhommel, F., Mustafa, G., Leiss-Maier, F., Klimper, L., Badmann, T., Heider, A., Wille, I.C., Groll, M., Sattler, M., Zeymer, C. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9quj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | apPol-DNA complex (binary 1) | | Authors: | Lahiri, I., Kumari, A. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9qui | | Status: | HOLD -- hold until a certain date | | Title: | Ni(II)-bound de novo protein scaffold TFD-EH | | Authors: | Wagner Egea, P., Delhommel, F., Mustafa, G., Leiss-Maier, F., Klimper, L., Badmann, T., Heider, A., Wille, I.C., Groll, M., Sattler, M., Zeymer, C. | | Deposition date: | 2025-04-10 | | Release date: | 2026-04-10 | | Sequence: | >Entity 1
GAMGDILIVWAKDVDEMLKQVEILRRLGAKQIAVESSDWRILQEALKKGGDILIVNGGGMTITFRGDDLEALLKAAIEMIKQALKFGATITLSLDGNDLNINITGVPEQVRKELAKEAERLAKEFGITVTRTGGGDVDEMLKQVEILRRLGAKQIAVHSDDWRILQEALKKG
|
|
| PDBID: | 9quh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of human MTH1 in complex with 8DG by MicroED using high electron fluence | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9quk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of human MTH1 in complex with 8DG by MicroED using low electron fluence | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9qum | | Status: | HPUB -- hold until publication | | Title: | Structure of lysozyme by continuous serial electron diffraction (SerialED) | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9quo | | Status: | HOLD -- hold until a certain date | | Title: | Co(II)-bound de novo protein scaffold TFD-EH T87E | | Authors: | Wagner Egea, P., Delhommel, F., Mustafa, G., Leiss-Maier, F., Klimper, L., Badmann, T., Heider, A., Wille, I.C., Groll, M., Sattler, M., Zeymer, C. | | Deposition date: | 2025-04-10 | | Release date: | 2026-04-10 | | Sequence: | >Entity 1
GAMGDILIVWAKDVDEMLKQVEILRRLGAKQIAVESSDWRILQEALKKGGDILIVNGGGMTITFRGDDLEALLKAAIEMIKQALKFGATIELSLDGNDLNINITGVPEQVRKELAKEAERLAKEFGITVTRTGGGDVDEMLKQVEILRRLGAKQIAVHSDDWRILQEALKKG
|
|
| PDBID: | 9qup | | Status: | HOLD -- hold until a certain date | | Title: | Tb(III)-bound de novo protein scaffold TFD-EE MPNN | | Authors: | Wagner Egea, P., Delhommel, F., Mustafa, G., Leiss-Maier, F., Klimper, L., Badmann, T., Heider, A., Wille, I.C., Groll, M., Sattler, M., Zeymer, C. | | Deposition date: | 2025-04-10 | | Release date: | 2026-04-10 | | Sequence: | >Entity 1
MMTFIVWALNKDEMLKNIEALRKAGAKNIAVESGDFDILRAAIEAGVETIVVSGGGLTIVFTGADRAALRRAAKRLLDAALELGAVVTVALDGDALRVRITGVPEQDLERLRALARELAAEFGIEVEVRGGGTPERALREIQELRELGAKNIWVESANVDWLLKLLKLS
|
|
| PDBID: | 9qug | | Status: | HPUB -- hold until publication | | Title: | Structure of a UBC-Ubiquitin conjugate | | Authors: | Kordic, D., Williams, T.L., Luiza Deszcz, L., Ehrmann, J., Arnese, R., Meinhart, A., Clausen, T. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9qua | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | apPol-DNA-nucleotide complex (ternary 1) | | Authors: | Lahiri, I., Kumari, A. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9quc | | Status: | HPUB -- hold until publication | | Title: | Metal-free de novo protein scaffold TFD-EH | | Authors: | Wagner Egea, P., Delhommel, F., Mustafa, G., Leiss-Maier, F., Klimper, L., Badmann, T., Heider, A., Wille, I.C., Groll, M., Sattler, M., Zeymer, C. | | Deposition date: | 2025-04-10 | | Sequence: | >Entity 1
GAMGDILIVWAKDVDEMLKQVEILRRLGAKQIAVESSDWRILQEALKKGGDILIVNGGGMTITFRGDDLEALLKAAIEMIKQALKFGATITLSLDGNDLNINITGVPEQVRKELAKEAERLAKEFGITVTRTGGGDVDEMLKQVEILRRLGAKQIAVHSDDWRILQEALKKG
|
|
