| PDBID: | 9k4k | | Status: | HPUB -- hold until publication | | Title: | Structure of substrate-engaged human 26S proteasome RP-CP subcomplex in state EA1.1 | | Authors: | Wu, Z., Chen, E., Mao, Y. | | Deposition date: | 2024-10-21 | | Release date: | 2026-04-21 |
|
| PDBID: | 9k4r | | Status: | HPUB -- hold until publication | | Title: | Structure of substrate-engaged human 26S proteasome RP-CP subcomplex in state EB.1 | | Authors: | Wu, Z., Chen, E., Mao, Y. | | Deposition date: | 2024-10-21 | | Release date: | 2026-04-21 |
|
| PDBID: | 9h4l | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | dCas9 bound to off-target 2 EMX1-1 (-)SC DNA minicircle | | Authors: | Quentin, Q.M., David, D.S. | | Deposition date: | 2024-10-20 | | Release date: | 2026-04-20 |
|
| PDBID: | 9e0r | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a single nucleosome (1) focus of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome | | Authors: | Xie, X., Zhou, X.E., Worden, E.J., Jones, P.A. | | Deposition date: | 2024-10-18 | | Release date: | 2026-04-17 |
|
| PDBID: | 9e0f | | Status: | HPUB -- hold until publication | | Title: | A focus of DNMT tetramer (1) of the cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome | | Authors: | Xie, X., Zhou, X.E., Worden, E.J., Jones, P.A. | | Deposition date: | 2024-10-17 | | Release date: | 2026-04-16 |
|
| PDBID: | 9jyc | | Status: | HPUB -- hold until publication | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in substrate-engaged state ED0.1_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 | | Release date: | 2026-04-12 |
|
| PDBID: | 9jye | | Status: | HPUB -- hold until publication | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in substrate-engaged state ED1.1_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 | | Release date: | 2026-04-12 |
|
| PDBID: | 9jy7 | | Status: | HPUB -- hold until publication | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in state EA2.1 | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 | | Release date: | 2026-04-12 |
|
| PDBID: | 9jy8 | | Status: | HPUB -- hold until publication | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in state EA2.1_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 | | Release date: | 2026-04-12 |
|
| PDBID: | 9jyg | | Status: | HPUB -- hold until publication | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in substrate-engaged state ED2.1_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 | | Release date: | 2026-04-12 |
|
| PDBID: | 9jyk | | Status: | HPUB -- hold until publication | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in substrate-engaged state ED4.1_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 | | Release date: | 2026-04-12 |
|
| PDBID: | 9h0t | | Status: | HPUB -- hold until publication | | Title: | N terminal domain of BC2L-C lectin (1-131) in complex with a beta-fucosylamide side-product | | Authors: | Antonin, G., Varrot, A. | | Deposition date: | 2024-10-09 | | Release date: | 2026-04-09 | | Sequence: | >Entity 1 GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA
|
|
| PDBID: | 9h0u | | Status: | HPUB -- hold until publication | | Title: | N terminal domain of BC2L-C lectin (1-131) with covalent beta-fucosylamide ligand | | Authors: | Antonini, G., Varrot, A. | | Deposition date: | 2024-10-09 | | Release date: | 2026-04-09 | | Sequence: | >Entity 1 GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA
|
|
| PDBID: | 9jo1 | | Status: | HPUB -- hold until publication | | Title: | NMR Solution structure of the 2:1 Berberine-BLM-G4 Complex | | Authors: | Wang, K.B. | | Deposition date: | 2024-09-24 | | Release date: | 2026-03-24 |
|
| PDBID: | 9dqe | | Status: | HPUB -- hold until publication | | Title: | NMR Solution structure of the 2:1 Coptisine- BLM-G4 Complex | | Authors: | Wang, K.B. | | Deposition date: | 2024-09-24 | | Release date: | 2026-03-23 |
|
| PDBID: | 9doh | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of LptB2FG apo-1 | | Authors: | Su, C. | | Deposition date: | 2024-09-19 | | Release date: | 2026-03-18 |
|
| PDBID: | 9gu8 | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to a FDA ligand 4 | | Authors: | Munoz-Reyes, D., Perez-Suarez, S., Sanchez-Barrena, M.J. | | Deposition date: | 2024-09-19 | | Release date: | 2026-03-19 |
|
| PDBID: | 9gu6 | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to FDA ligand 3 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2024-09-19 | | Release date: | 2026-03-19 |
|
| PDBID: | 9gua | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to FDA ligand 5 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2024-09-19 | | Release date: | 2026-03-19 |
|
| PDBID: | 9dn8 | | Status: | HPUB -- hold until publication | | Title: | RamR variant S2.3 complexed with 1S-1-phenyl-1,2,3,4-tetrahydroisoquinoline | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2024-09-17 | | Release date: | 2026-03-16 |
|
| PDBID: | 9dn9 | | Status: | HPUB -- hold until publication | | Title: | RamR variant S2.4 complexed with 1S-1-phenyl-1,2,3,4-tetrahydroisoquinoline | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2024-09-17 | | Release date: | 2026-03-16 |
|
| PDBID: | 9dnc | | Status: | HPUB -- hold until publication | | Title: | Apo crystal structure of RamR variant D2.1 | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2024-09-17 | | Release date: | 2026-03-16 |
|
| PDBID: | 9dnh | | Status: | HPUB -- hold until publication | | Title: | RamR variant D2.3 complexed with 1-phenyl-dihydroisoquinoline | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2024-09-17 | | Release date: | 2026-03-16 |
|
| PDBID: | 9dnk | | Status: | HPUB -- hold until publication | | Title: | RamR variant R2.1 complexed with 1R-1-phenyl-1,2,3,4-tetrahydroisoquinoline | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2024-09-17 | | Release date: | 2026-03-16 |
|
| PDBID: | 9gsa | | Status: | HPUB -- hold until publication | | Title: | Lys9DabMC6*a 1-Delta | | Authors: | Maglio, O., Lombardi, A., Chino, M., Pirro, F. | | Deposition date: | 2024-09-13 | | Release date: | 2026-03-13 |
|